KEGG   Massilia sp. NR 4-1: ACZ75_19210
Entry
ACZ75_19210       CDS       T04026                                 

Name
(GenBank) monooxygenase
  KO
K20090  violacein synthase [EC:1.14.13.224]
Organism
mnr  Massilia sp. NR 4-1
Pathway
mnr00404  Staurosporine biosynthesis
mnr01100  Metabolic pathways
mnr01110  Biosynthesis of secondary metabolites
mnr02024  Quorum sensing
Module
mnr_M00808  Violacein biosynthesis, tryptophan => violacein
Brite
KEGG Orthology (KO) [BR:mnr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    ACZ75_19210
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ACZ75_19210
Enzymes [BR:mnr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.224  violacein synthase
     ACZ75_19210
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase DAO NAD_binding_8 Pyr_redox_2 GIDA Pyr_redox SE FAD_binding_2 HI0933_like FAD_oxidored 3HCDH_N UDPG_MGDP_dh_N ApbA AlaDh_PNT_C Pyr_redox_3 TrkA_N
Other DBs
NCBI-ProteinID: AKU23268
UniProt: A0A0K1K227
Position
complement(4605300..4606586)
AA seq 428 aa
MHKIIIVGGGLAGSLTAIYLAQRGHHVQVVEKRSDPLQENPKADPINSRAIGVSMTVRGI
KAVLGAGISKQDLDQCGEPVVGMAFCVRGQYKVRELHPLEGLYPLSLNRNAFQRLLNKYA
ALHKVKYHFEHKCLDVDLDRKTVLIQGPDGALQHLHGDLIIGADGAHSAVRRAMQSSMRR
FEFKQTFFRHGYKTVVLPKAEALGFRKDLLYFFGMDSRGLFAGRAATIPDGSISFAICLP
YTGTPSLATQNPEAMAEFFNRYFSMLPEASRQELMEQYIALPSNDLINVRSSTFHYKGNM
LLIGDAAHATAPFLGQGMNMALEDVHVFVKLLEKHGNALDLTLSDFTRLRKVEADAMQDM
AIANYETLSNPNLIFFLQTRYTRYMHKKFPRVYPPDMAEKLYFTSVPYDELQQIQKKQNV
WYKLGRVN
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgcacaaaatcattatcgtcggcggcggcttggcaggtagcctcaccgccatctatctg
gcgcaacgcggacaccatgtccaggttgtggaaaagcgcagcgacccgctgcaggaaaac
cccaaagccgatccgatcaactcgcgcgccatcggcgtcagcatgacggtgcgcggcatc
aaggcggtgctcggggccggcatcagcaagcaggatctggatcagtgcggcgaacccgtg
gtcggcatggcgttttgcgtgcgcggccaatacaaggtgcgcgagctgcatccgctcgaa
ggcctgtatcccctgtcgctgaaccgcaatgccttccagcgcctgctcaacaaatacgcc
gccctgcacaaggtgaaataccacttcgagcataaatgcctggacgtcgacctggaccgc
aaaaccgtgctgatccaggggccggacggcgccctgcagcatctgcatggcgacctgatc
atcggcgccgacggcgcccactcggcggtgcggcgcgccatgcaaagcagcatgcggcgc
ttcgagttcaagcagaccttcttccgccacggctacaagaccgtggtgctgccgaaggcc
gaggcgctcggcttccgcaaggacctgctgtacttcttcggcatggattcgcgcggcctg
ttcgccggccgcgccgccaccatcccggacggcagcatcagcttcgccatctgcctgccc
tataccggcacgcccagcctggcgacgcagaatccggaagccatggccgagttcttcaac
cgctatttcagcatgctgccggaggccagccgccaggagctgatggaacagtacatcgcg
ctgccgagcaacgacctgatcaatgtccgttccagcaccttccactacaagggcaatatg
ctgctgatcggcgacgcggcgcacgccaccgcgccgttcctgggccagggcatgaatatg
gcgctggaggacgtgcacgtcttcgtcaagctgctggaaaaacacggcaatgcgctggac
ctgaccttgtccgacttcacccgcctgcgcaaggtggaggccgacgccatgcaggatatg
gcgatcgccaactacgaaacgctgagcaacccgaatctgattttcttcctgcagacccgg
tacacccgctatatgcacaagaaattcccccgcgtttatccgcccgatatggcggagaaa
ctgtacttcacatcggttccctacgatgagctgcagcaaatccagaagaagcaaaacgtt
tggtacaaacttggaagggtaaattaa

DBGET integrated database retrieval system