Mycobacterium orygis: MO_001249 Help Entry MO_001249         CDS       T09544                                  Symbol mutT Name (GenBank) 8-oxo-dGTP diphosphatase MutT   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism mory  Mycobacterium orygis Brite KEGG Orthology (KO) [BR:mory00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:mory03400]     MO_001249 (mutT) Enzymes [BR:mory01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      MO_001249 (mutT) DNA repair and recombination proteins [BR:mory03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     MO_001249 (mutT)  Prokaryotic type     MO_001249 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 Nudt16-like NUDIX_2 Motif Other DBs NCBI-ProteinID:  WPF63362 UniProt:  A0AAU0QAV8 Position 1294196..1294621 Genome browser AA seq 141 aa AA seqDB search MLNQIVVAGAIVRGCTVLVAQRVRPPELAGRWELPGGKVAAGETERAALARELAEELGLE VADLAVGDRVGDDIALNGTTTLRAYRVHLLGGEPRARDHRALCWVTAAELHDVDWVPADR GWIADLARTLNGSAADVHRRC NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgctgaatcagatcgtggttgccggagccatcgtccgcggttgcacggtcttggtggcg caacgcgttcggccaccggagttggcgggtcgttgggaacttcccggcggtaaggtcgcc gccggcgaaaccgagcgcgccgcgctggcccgagagctcgccgaagaactgggactcgag gtcgccgacctcgcggtgggcgaccgtgtgggcgacgatattgcgttgaacggcacgacg acgctgcgggcctatcgcgtgcatctgcttggcggcgaaccgcgtgcgcgtgaccaccgg gcgctgtgctgggtgacggcggccgaactgcacgatgtcgactgggtaccagccgaccgc ggctggattgcggacctggcgcgaaccctcaacgggtccgccgcagatgtccaccgtcgc tgttag

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (4) Pfam (4) All databases (6) Download RDF

DBGET integrated database retrieval system