KEGG   Methylogaea oryzae: MoryE10_07670
Entry
MoryE10_07670     CDS       T07433                                 

Name
(GenBank) sugar kinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
moz  Methylogaea oryzae
Brite
KEGG Orthology (KO) [BR:moz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MoryE10_07670
Enzymes [BR:moz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     MoryE10_07670
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: BBL70161
Position
complement(798227..799135)
AA seq 302 aa
MRQPERFVCVGSLNVDITFPVERLPEEHEKLRCDGALISQGGSAANTAHWLARLGHATVM
LGCVGDDAFGSVAVAALAAVGVDTRHIQRTTQAATGLAAVFAGPAGKRMVTSGGANACFD
PGQAPAELFSPGTHLHVATPLAGIAHPLLRLAKSRGATTSCDLDLGPPTDWLPWLDIGFV
NHTELARWLGTDDPEQAWNRLQAPANFSLVVTLGAHGAAAWNRDGGTAVPAAAVDVVDRT
GGGDAFDAGYLHALGRSEAERLRCGLDLAAQVIARRGARPEAVEPACLCPSAQPHRHAMP
AP
NT seq 909 nt   +upstreamnt  +downstreamnt
atgcgacagccggagcgtttcgtctgcgtcggcagcctcaacgtggacatcacgttcccc
gtcgagcggctgcccgaagaacacgaaaaactgcgttgcgatggtgccctcatctcccag
ggcggttcggccgccaataccgcccattggctggcccggctgggccacgccaccgtgatg
ctgggctgtgtgggtgacgacgctttcggtagtgtagccgtcgccgccctggcggcggtg
ggcgtggacacccgccacatccagcgcacgacgcaagcggctaccggccttgccgccgtg
ttcgccgggccggccggcaagcgcatggtcacctccggcggggcaaacgcctgcttcgac
cccggccaggcgccggccgagctgttctcgcccggcacgcatcttcacgtcgccacgccg
ttggccggcatcgcccacccgctgctgcgcctcgccaaaagccgcggcgccaccacctcc
tgcgacctggacctcggtccgccgacagactggctgccctggctggacatcggcttcgtc
aaccacacggaactggcccgctggctgggcacggacgatccggagcaggcctggaatcgg
ctacaagccccggcgaacttcagcctggtcgtcaccctgggagcccacggcgccgccgct
tggaaccgcgacggcggcaccgcagtgccggccgccgccgtggacgtggtcgaccgcacc
ggcggcggcgacgccttcgacgccggctatctccatgccctgggccgcagcgaagccgaa
cggctgcgctgcggactcgaccttgccgcccaggtcatcgcccggcgcggcgcacggccc
gaggcggtggagccggcctgcctctgtcccagcgcacaaccccaccgccacgcgatgccg
gcgccttag

DBGET integrated database retrieval system