KEGG   Mycobacterium pallens: K0O64_27615
Entry
K0O64_27615       CDS       T07675                                 

Symbol
hcaB
Name
(GenBank) 3-(cis-5,6-dihydroxycyclohexa-1,3-dien-1-yl)propanoate dehydrogenase
  KO
K18255  phthalate 3,4-cis-dihydrodiol dehydrogenase [EC:1.3.1.-]
Organism
mpae  Mycobacterium pallens
Pathway
mpae00624  Polycyclic aromatic hydrocarbon degradation
mpae01100  Metabolic pathways
mpae01120  Microbial metabolism in diverse environments
mpae01220  Degradation of aromatic compounds
Module
mpae_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mpae00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    K0O64_27615 (hcaB)
Enzymes [BR:mpae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     K0O64_27615 (hcaB)
SSDB
Motif
Pfam: adh_short adh_short_C2 TrkA_N Epimerase THF_DHG_CYH_C
Other DBs
NCBI-ProteinID: QYL16703
Position
complement(5638884..5639687)
AA seq 267 aa
MTGWLAGKRALIVGAGSGIGRATVDAFLNEDARVAVLEYDSGKCATLRQQLPDVPVIEGD
GTTRTANDEAVQVAVDAFGGLDTLVNCVGIFDFYRRIQDIPAERIDQAFDEMFRINVLSH
IHSVKAAVPALMGQDGASIVLTESASSFYPGRGGLLYVASKFAVRGVVTALAHELAPRIR
VNGVAPGGTLNTDLRGLDSLDLGARRLDAAPDRARELAARTPLGVALSGEDHAWSYVFLA
SHRSRGLTGETIHPDGGFSLGPPPQRN
NT seq 804 nt   +upstreamnt  +downstreamnt
atgactggctggctggcgggcaaacgcgcgttaatcgtgggagcaggttcgggtatcggt
cgggccacggtcgacgcgttcctgaacgaggatgcccgggtggccgtgctcgagtacgac
agcggtaagtgcgccacgctgcgccagcagctgcccgacgttccggtgatcgagggcgat
gggaccactcgcaccgccaacgacgaagcagtgcaggtcgctgtcgacgccttcggcgga
ctcgacacattggtgaactgcgtggggattttcgatttctaccgccgtattcaggacatc
cccgccgagcgaatcgaccaggcgttcgacgaaatgtttcgcatcaacgtcctgagtcat
atccactcagtcaaggcagcagtgccggcgctgatgggccaggacggcgcctcgatcgtg
ctcaccgagtccgcgtcatcgttctatccaggacgcggcggcctgctgtatgtggcgtcg
aagttcgcggtgcgcggcgtagtcactgcactggctcacgaactcgcgccgaggatccgt
gtgaacggtgtcgcccccggggggacgttgaacaccgacctgcgcggactcgacagcctc
gaccttggcgcccgccgtctggatgctgcaccagatcgggcccgcgaattggctgctcgc
acaccgctgggcgtggccctatcgggtgaagaccacgcgtggagttacgtcttcctcgct
tctcaccgctcccgcgggctcaccggcgaaacgatccatcccgacggcggtttcagcctc
ggacccccaccccagcggaattga

DBGET integrated database retrieval system