KEGG   Methanolacinia petrolearia: Mpet_1190
Entry
Mpet_1190         CDS       T01312                                 
Name
(GenBank) Protein of unknown function DUF2109, membrane
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mpi  Methanolacinia petrolearia
Brite
KEGG Orthology (KO) [BR:mpi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Mpet_1190
SSDB
Motif
Pfam: DUF2109
Other DBs
NCBI-ProteinID: ADN35951
UniProt: E1RDJ8
Position
1221289..1221531
AA seq 80 aa
MIAVAVTAVIAVYAVIRIIAEKETLRKFTYLNVMNFAIAATIPLLIADPLALIAAIAYFV
GSTLESNAIASAYALRRDGK
NT seq 243 nt   +upstreamnt  +downstreamnt
atgatcgccgtcgcagtaacagcagtgatcgcagtctatgcagtgatcaggataatagcc
gagaaggagacgctcaggaagttcacctatctcaatgtcatgaacttcgcaatcgccgcg
accatccctctgctgatcgcagacccgctcgcattgatcgcagcgatcgcgtacttcgtc
ggctcaacgctcgaatcgaatgccatcgcaagtgcatatgcattaaggagggacgggaaa
tga

DBGET integrated database retrieval system