KEGG   Methanolobus psychrophilus: Mpsy_1725
Entry
Mpsy_1725         CDS       T02280                                 

Name
(GenBank) hypothetical protein
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mpy  Methanolobus psychrophilus
Brite
KEGG Orthology (KO) [BR:mpy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mpsy_1725
Enzymes [BR:mpy01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     Mpsy_1725
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4_6 Fer4 Fer4_7 Fer4_9 Fer4_21 Fer4_8 Fer4_16 Fer4_17 Fer4_2 Fer4_10 MHC_II_alpha IL33
Other DBs
NCBI-ProteinID: AFV23932
Position
1693387..1695015
AA seq 542 aa
MYVISLDLGTSGFRSQLIDLEKQETIKTVITMGHPLPGGNVMDHLDFAISTGTEVAHRLM
VETVKKILEKFDVEPEKILRIAVCGNPIQLSLFQNIEIRDLAYAGKNKQAALGVQDVKRD
ARVFPANDIFKGIFEMDNCEIIIPPAIKHEIGADALAMMLETDFINQKEPCLVTDYGTNA
EMALKIGDRIMTASAAAGPAIEGQGIDCGMLAGPGAISDVNEENGYWRLTVLDAALNPVK
GPLVDPLTGNTIESSEAFPKGITGTGVISTIALAIKEGLIRKLPKLPNGKITLGDGISIT
DKDVEEVGKAIGAIRAAHMTLMVEAGLKYEDLMYSYMSGATGTYVDAEKARHIGSVPGFS
KKIVQFGNTSIGLARKIAIDRSKLDEVTEVAKRIQADHVMMATSETFKEIYMCELSTWQQ
GMPAEMYAQMLQMYGIPPFPEDLKVVEIEKRVRKDIDDVGYLGLEIVKDIGIILEAPVEK
CVLCHQCEEECPEDALFIIENKEGRFVDIDSQNCLGTSCRRCVTICPEQAINHSLLKIKE
KE
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgtatgtgatatctctggaccttggaacaagcggtttcaggtcgcaactgatagacctt
gagaagcaggagaccatcaagacggtgatcaccatggggcatccgctccctggaggcaat
gtgatggaccatctggattttgctatttcgacgggaactgaagttgcacaccggctcatg
gtggaaaccgtgaagaaaatactggagaagtttgacgtggagcctgaaaagatcctccgc
attgcagtatgcgggaaccctatacaactttccctgttccagaatatagagatcagggat
cttgcatacgcaggaaagaataagcaggcagcattaggggtccaggatgtcaaaagggat
gcaagggtttttcctgcaaatgatatatttaaaggtatctttgaaatggacaactgtgag
ataattatcccgcctgccataaagcacgagataggtgccgatgccctggcaatgatgctg
gagactgactttataaaccagaaagaaccatgtctagttacggactatggtacaaatgct
gaaatggctctaaagataggcgacaggataatgacagcaagcgcagcagcaggccctgcc
atcgaaggacagggtatagactgcggtatgcttgcggggccgggagcaataagcgatgtc
aacgaggaaaacggttactggagactcacggtgcttgacgcggccctgaatccggtaaaa
ggaccgcttgtggaccctctcacagggaataccatagagagctcggaagctttccccaag
ggtatcacaggcacaggggtcatttccactattgcacttgcaattaaggaagggcttatc
aggaaacttcccaagcttcccaatggaaagataacgcttggcgacgggatctccatcacg
gataaggatgttgaggaggttggaaaggctataggagccataagggcagcacatatgaca
ctcatggtcgaagcgggcttgaaatacgaggacctaatgtactcttacatgtccggcgca
acgggcacctatgtggatgcggaaaaagcaaggcatataggctcagttccgggattttcc
aaaaaaatagtccagttcgggaacacttctataggacttgcgcggaagatagctatcgac
cgctctaaactcgatgaggtcacagaggtcgcaaaaagaatacaggccgaccatgtgatg
atggctaccagtgagacattcaaagaaatctacatgtgtgaactttccacatggcaacag
ggaatgcctgccgagatgtatgcccagatgctgcagatgtatggcattccaccgttcccg
gaggacctcaaggttgtagagatcgagaaaagggtcaggaaagatatcgacgatgtagga
taccttggccttgaaattgtaaaggacatcggaataatactggaagctccagtggaaaag
tgcgtactttgccaccagtgcgaagaggagtgccctgaggatgcgctgttcattatcgaa
aataaggaaggaaggtttgtagacatcgacagccagaactgtcttggtacaagttgcagg
cgctgcgtgaccatctgccccgagcaggccatcaatcattccctgctgaagataaaggaa
aaagagtaa

DBGET integrated database retrieval system