KEGG   Mycolicibacterium rhodesiae: MycrhN_2949
Entry
MycrhN_2949       CDS       T01685                                 

Name
(GenBank) methionine synthase II (cobalamin-independent)
  KO
K22363  2-hydroxypropyl-CoM lyase [EC:4.4.1.23]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00625  Chloroalkane and chloroalkene degradation
mrh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MycrhN_2949
Enzymes [BR:mrh01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.23  2-hydroxypropyl-CoM lyase
     MycrhN_2949
SSDB
Motif
Pfam: Meth_synt_2 Meth_synt_1 Caudo_bapla16
Other DBs
NCBI-ProteinID: AEV73504
UniProt: G8RJD4
Position
2952134..2953240
AA seq 368 aa
MKVGSTDVLLPTTMVGNYPNPRWYDGHGFAQFPKGEFVYDAISREAFEDAVLAIVHDQEA
AGLDVISDGKVYGGDSPYASIIYHYYERMSGFRPSGTNIGLPIYSTLYSPIVESEVHREH
PFHLATLRATRKATKKPVKVSYVGIQVLAAAATNNFYSEERELGMAIAKAFKEDFKEIEQ
NGCDIIQLDEFVWPYGIGDWEVDAINYAMEGISCDFWVHTCWGNYSGTPGYLPEENEKEF
GAWVLDKRTSHSAGTERAAAIFPKVLDTNITALNYEVGRTGPDDLKPLVDNNWNRPFVAG
VIDVKSTITETADEVADRIRSVLEFVPAEQLALSTDCGLINLNRMIAASKLHALADGAAI
VRAELNQP
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaaagttgggtcgaccgacgtactgctgcccacgacaatggttggcaattatccgaac
ccgcgatggtacgacggacacggattcgctcaattccccaagggggaatttgtctacgac
gcgattagcagggaagcgtttgaagatgcggttctggctatcgtccacgaccaagaagcg
gctggactcgacgtcatttccgacggcaaggtgtatggcggagattcaccgtatgcgtcg
atcatctatcactactacgagcgtatgagcggattcagaccgtcgggaacaaatatcgga
ctgccgatctattccaccctgtattcgccgatcgtggaatccgaagtacatcgcgagcat
ccctttcatctcgcgacgcttcgagccacccgcaaggcaacgaagaagccagtcaaggtg
tcctacgtgggtattcaggtgctggccgcagcggcgacgaacaatttttactccgaagaa
cgcgaactgggcatggccatcgcgaaggcgttcaaagaggatttcaaagagatcgagcag
aacggctgcgacatcatccaactcgacgagttcgtgtggccgtatggcatcggggactgg
gaggttgatgcgatcaactacgcgatggagggcatcagctgtgacttctgggttcatacc
tgctggggaaattactcgggcacgccgggctacctgccggaggagaacgaaaaggaattc
ggtgcctgggtcctggataagaggaccagtcactcggccgggactgagcgtgcggcggca
atcttcccgaaggtgctcgacaccaacatcaccgcgttgaactacgaggtgggccggact
ggtcccgatgatctcaaaccactcgtcgacaacaactggaaccgaccgttcgtcgctggc
gtcatcgacgtcaagtcgacgatcaccgaaacggcagacgaggtagccgaccggatcagg
tcggtgctggaattcgtcccggctgagcagcttgcgctgtccacggactgcggattgatc
aacctcaaccgcatgatcgcagcgagcaaactgcacgctctcgccgacggcgcggcaatc
gttcgtgccgaactcaaccagccgtaa

DBGET integrated database retrieval system