KEGG   Mycolicibacterium rhodesiae: MycrhN_2951
Entry
MycrhN_2951       CDS       T01685                                 

Name
(GenBank) Methane/Phenol/Toluene Hydroxylase
  KO
K22354  alkene monooxygenase beta subunit [EC:1.14.13.69]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00625  Chloroalkane and chloroalkene degradation
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MycrhN_2951
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.69  alkene monooxygenase
     MycrhN_2951
SSDB
Motif
Pfam: Phenol_Hydrox
Other DBs
NCBI-ProteinID: AEV73506
UniProt: G8RJD6
Position
2953708..2954760
AA seq 350 aa
MAGNHVAPQREVLSGNRTFTWVQPKGKRPTEYEDLTVGQQSTPAQFAFQGWPLRFDDGRD
PYTADSTVLRSSDWYEYRDPNQTMNRSYIAGVHEAEKALQNTFIGADAAGLFDFAKPQWV
NEGLSKHYMTYPFVEYGMFLALCYAEREALSDTITFSMVFEAADKLRHLQDVVYYSFELA
EAHPDFDDSDSLQVWKEDPVWQGAREAIENVIALDDWMEVIVALNLCFDQLFGELAKIEY
FSRFAGANGDLVTPSVIASSEADTVRTRAWTKELIRHLVEDPEHGDHNRSIISSWIAKWN
AYSVKACDAFAPVFSQAPVQPTTYEDAMDEIRAKQSRYLAEINLEPLLVN
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggctggtaaccacgtggcaccgcagcgtgaggtcctttccggaaaccggacctttacg
tgggtgcagccaaagggaaaacgccccaccgagtatgaggatctcaccgtcggccagcag
tccacccccgcgcaattcgcgttccagggttggccgctccgttttgacgacggtcgcgat
ccttacaccgcagattcgaccgtactgcggtcatccgactggtatgaatatcgcgacccg
aatcagacgatgaaccggtcctatatcgccggcgttcacgaagccgaaaaggctttgcag
aacacgtttatcggcgctgatgcggcgggactgttcgacttcgccaagccgcagtgggtg
aacgaaggcctttccaagcactacatgacctacccgttcgtcgagtacggcatgttcctc
gcgttgtgctacgccgagcgagaggcgctgtccgacaccattaccttctcgatggttttc
gaggctgccgacaaactgcgccacctgcaggatgtcgtctattactcgtttgaactggcg
gaggcgcatcccgacttcgacgattccgactcccttcaggtctggaaggaagatccagta
tggcagggagcccgcgaagccatcgagaatgtcatcgctctcgacgactggatggaagtc
atcgtcgcgttgaatctctgcttcgaccagttgttcggcgaactggcaaaaatcgagtac
ttctcccgattcgctggcgccaatggcgatttggtgacgccatcggtcatcgcctcttct
gaggcggacaccgtgagaacgcgtgcgtggacgaaggaattgatacgccatctcgtcgag
gatcccgagcacggcgaccacaacagatccatcatcagctcgtggattgcgaagtggaac
gcctactccgtgaaggcctgcgatgcgttcgccccggtcttctcgcaggccccggtgcag
ccaaccacctacgaggatgcgatggatgagattcgcgccaaacaaagtcggtaccttgcc
gaaattaacctcgaacccctactcgtcaactag

DBGET integrated database retrieval system