KEGG   Mycolicibacterium rhodesiae: MycrhN_2952
Entry
MycrhN_2952       CDS       T01685                                 

Name
(GenBank) MmoB/DmpM family protein
  KO
K22355  alkene monooxygenase coupling protein
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00625  Chloroalkane and chloroalkene degradation
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MycrhN_2952
SSDB
Motif
Pfam: MmoB_DmpM
Other DBs
NCBI-ProteinID: AEV73507
UniProt: G8RJD7
Position
2954783..2955112
AA seq 109 aa
MSAPTPPRDRTKVRDTVGISLIGSEETNVAVDMVAELMPEAKITDHDVFYKIERDGMLSF
DMNELSDRLGKPYTVHDFLVNMTSYYGRIVVKDHEIEIHSEILPERFRD
NT seq 330 nt   +upstreamnt  +downstreamnt
gtgtcagcccccacacccccacgggaccgcactaaagttcgtgacaccgttgggatttca
ttgatcggaagcgaagagaccaacgttgctgtagacatggtcgctgagctgatgccggag
gccaagatcaccgaccacgacgtcttctacaagatcgagcgtgacggcatgctgagcttc
gacatgaacgaactcagcgatcgacttggcaagccctacaccgtccatgacttcctcgtg
aacatgacctcgtactacggccggattgtcgttaaggatcacgagatcgagatccattcg
gagatcctgccggaacgattccgcgactga

DBGET integrated database retrieval system