KEGG   Mycolicibacterium rhodesiae: MycrhN_2978
Entry
MycrhN_2978       CDS       T01685                                 

Name
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component
  KO
K22364  2-oxopropyl-CoM reductase (carboxylating) [EC:1.8.1.5]
Organism
mrh  Mycolicibacterium rhodesiae
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MycrhN_2978
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.5  2-oxopropyl-CoM reductase (carboxylating)
     MycrhN_2978
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 Pyr_redox FAD_binding_2 HI0933_like FAD_oxidored K_oxygenase NAD_binding_7
Other DBs
NCBI-ProteinID: AEV73526
UniProt: G8RKC4
Position
2979194..2980819
AA seq 541 aa
MLKTAADNLRVRRYRKGWILMDLIDTTLSMDRWEDLIHDAETGVVSEPLENVYRKRGTAF
DVIFVGGGAGGRFGSAYAQARGLRQLVIDKWPFLGGSCPHQACVPHHLFSEAAREMDYMR
WNSDTLWFPKFEEERASIVDMITLFKKGRNNAHAFMNWQSKEQLDMEYILNAEAIVIDKH
TVEVNGERFTTQSLVLATGTRTHFPPEIAGLDKAGVYDFATLIDPGLDYEPTSCVIIGGS
KVAMEYGSFFQATGCHTTILTRSALMRTESLHHVDEDLRTYVVDNMRLRGMDIIEGCEPL
EVVGDDRAAGVLVRLADGTEEVIETDFVFIGTGERPNTKPYVDALGIEVDKKGFVKVNSR
MQTSVEGVYAIGDLIGSPMEMFKARKCGMTAARNISGEAFEFDFTEFPDFLHTTYEVTWV
GLTEQEARDAYGDISVIQMPPKGIRHEELSLPLAEGSMLYGFTRPELTGFQKCIYDNKSR
RLLGAHHCGFGAKDAFQYLDHLIKKGITIDEMGEMNELFLNPEHFIQLSRLRAGNPDLQD
L
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgcttaagacagccgccgacaatctccgggtccggagataccgaaagggatggattctg
atggacttgattgacaccactctcagcatggaccggtgggaggatttgattcacgacgcc
gaaaccggggtggtttccgagccgctggagaatgtctatcgcaagcgggggaccgctttc
gatgtgatattcgtgggcggcggcgctggcggtcgattcgggtcagcctacgcccaggct
cgcggcctgcgtcaactggtgatcgacaaatggccgtttctcggcggttcctgcccgcat
caggcctgcgttccgcaccatctgttctccgaggccgcgcgcgagatggactacatgcgc
tggaattcagacacgttgtggttcccgaagttcgaggaggaacgcgcctcgatcgtcgac
atgatcactttgttcaagaagggccgcaacaacgcacacgctttcatgaactggcagagc
aaagaacagcttgacatggaatacattctcaacgccgaagcaatcgtcatcgacaagcac
accgtcgaggtcaacggagagcggttcaccacccaaagcctcgtgctcgctaccggaaca
cggacgcacttcccgcccgagatcgcagggttggacaaggccggcgtctatgacttcgca
acgctcatcgacccgggcctggattacgagccgaccagctgcgtcatcatcggcggctcc
aaagtcgcgatggagtacggctccttctttcaggcgaccggctgccacaccacgattctt
acccgtagcgcgctgatgcgaacggaaagtctgcaccacgtggacgaggatctgcgtacc
tacgtggtcgacaacatgcggttgcgcggcatggacatcatcgaaggctgtgagccgctg
gaagtcgtcggagacgaccgcgccgccggcgtactagtccgcttggccgacggcaccgag
gaggtcatcgagaccgacttcgttttcatcgggaccggcgagcgacccaacaccaagcct
tacgtggatgcgctgggcatcgaggtcgataagaagggtttcgtcaaagtcaattcccgg
atgcagacctccgtggagggggtgtatgcgatcggagatctcatcggatcaccgatggag
atgttcaaagcccgaaagtgtgggatgaccgctgcgcgcaacatctccggcgaggctttc
gagttcgacttcacggagtttcccgacttcctgcacaccacctacgaggtgacctgggtc
gggttgaccgaacaggaggcgcgcgacgcatacggcgatatttccgtcatccagatgccg
cccaaaggaatccgccacgaggagctgtctttaccgctggccgagggcagtatgctctac
ggcttcactcgcccggaactcaccggattccagaaatgcatctacgacaacaagagtcgc
cggctcttgggcgcccaccactgcggtttcggagccaaagacgcattccagtacctggac
catctcatcaagaagggcatcaccatcgacgagatgggcgagatgaacgaactgttcctc
aatcccgaacacttcatccagctctcccgtctgcgcgccggcaaccctgatcttcaagac
ctctag

DBGET integrated database retrieval system