KEGG   Mycolicibacterium rhodesiae: MycrhN_3145
Entry
MycrhN_3145       CDS       T01685                                 

Name
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K18255  phthalate 3,4-cis-dihydrodiol dehydrogenase [EC:1.3.1.-]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00624  Polycyclic aromatic hydrocarbon degradation
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
mrh01220  Degradation of aromatic compounds
Module
mrh_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MycrhN_3145
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     MycrhN_3145
SSDB
Motif
Pfam: adh_short adh_short_C2 TrkA_N Sacchrp_dh_NADP Epimerase NAD_binding_10 THF_DHG_CYH_C Shikimate_DH NAD_binding_7
Other DBs
NCBI-ProteinID: AEV73678
UniProt: G8RML1
Position
3153617..3154420
AA seq 267 aa
MTGWLAGKRALIVGAGSGIGRATIDAFLNEDAQVAVLEYDSDKCAALRQQLPDIPVIEGD
ATTRTANDEAVQVAVDAFGGLDTLVNCVGIFDFYRRIQDIPAERIDQAFDEMFRINVLSH
IHSVKAAVPALRGQDGASIILTESASSFYPGRGGLLYVASKFAVRGLVTALAHELAPRIR
VNGVAPGGTLNTDLRGLDSLDLGSRRLDAAPDRARELAARTPLNVALSGHDHAWSYVFLA
SHRSRGLTGETIRPDGGFSLGPAPQRN
NT seq 804 nt   +upstreamnt  +downstreamnt
atgactggctggctggcgggcaaacgcgcgttgatcgtcggagcaggttcgggtatcggt
cgggccactatcgacgcgttcctcaacgaggatgcccaggtcgccgtgctcgagtacgac
agcgataagtgcgccgcgctgcgccagcagctgcccgacatcccagtaatcgagggcgat
gcgaccacccgcaccgccaacgacgaagctgtgcaggtcgctgtcgacgcgtttggcgga
ctcgacacattggtgaactgcgtcgggatcttcgatttctaccgtcgtattcaggacatc
cccgccgagcgaatcgaccaggcgttcgacgagatgtttcgtatcaacgtcctgagtcat
atccactcagtcaaggcagcagtgccggcattgagggggcaggacggcgcctcgatcatc
ctcaccgagtccgcttcatcattttatccaggacgcggcggcctgctgtatgtcgcgtcg
aagttcgcggtgcgtggcctcgtcaccgcactggctcacgaactcgcgccgaggatccgt
gtgaacggtgtcgccccagggggaacgttgaacaccgacctgcgcggactcgacagtctc
gaccttggctcccgccgtcttgatgctgcacccgaccgggcccgcgaattggctgctcgc
acaccgctgaacgtggccctatcgggtcacgaccacgcgtggagttacgtctttctcgct
tcgcaccgctcccgcgggcttaccggcgaaacgatccgccccgacggcggtttcagcctc
ggacctgcaccccagcgcaattga

DBGET integrated database retrieval system