KEGG   Mycolicibacterium rhodesiae: MycrhN_3201
Entry
MycrhN_3201       CDS       T01685                                 

Definition
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K18257  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase [EC:1.3.1.49]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00624  Polycyclic aromatic hydrocarbon degradation
mrh01100  Metabolic pathways
mrh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MycrhN_3201
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.49  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase
     MycrhN_3201
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Other DBs
NCBI-ProteinID: AEV73734
UniProt: G8RMR7
Position
3209081..3209932
AA seq 283 aa
MSWLTGQVALVTGGAAGIGLAVVERFLAEGACVGVLDRSEGDLATIGSADGRLIAVTGDV
TAYDDNVRAVRETVDAFGKLDVFVGNAGIFDYFAPLIGFDGADLSSAFDEIFAVNVKGYL
LGARAAVPELLKSDGPSIIFTVSNSGFYASGGGPLYTASKHAVVGVVRELAYELAPKIRV
NGVAPGGTITGLRGIEDLGQGGNVLSSVPGIADMMSVTNPLQYAQQPADHAGLYLLLASA
DNSRAVTGVVINSDGGLGVRGLNQPSGGLGLATGEMRIDVPSP
NT seq 852 nt   +upstreamnt  +downstreamnt
ttgagttggttgaccggacaagtcgcacttgtgaccggcggggcagccggaatcggtttg
gccgtggtcgagcggttcttggccgagggtgcatgcgtgggtgtcttggatcgctcggaa
ggcgacctggctaccattggcagcgccgacggcaggctcatcgcggtaacaggtgacgtt
actgcgtatgacgacaatgtcagggcggtgcgcgaaacggtcgatgcgttcggaaagctc
gacgtgttcgtcggtaacgctgggatctttgactacttcgcccccttaataggtttcgac
ggcgccgacctcagcagcgccttcgatgagatcttcgcggtcaatgtcaaggggtacctc
cttggtgctagggccgccgttcctgaactcctcaaaagcgatgggcctagcatcattttc
accgtctccaactctggtttctatgcctctggtggcggcccgctatacaccgcttccaag
cacgcagtcgttggcgtagtgcgtgaactggcgtacgagttggcgccgaagatccgggtg
aatggcgtggctccaggcggcacgataacgggcctacgtggtatcgaagacctcggccag
ggtggaaacgtgttgtcatcggtgcccggcatcgccgacatgatgagtgtcacgaaccct
ctgcagtacgcgcagcagcctgccgatcatgccggcctgtacttgctactcgcgtctgca
gacaactcgcgcgcggtgaccggcgtcgtcatcaacagtgacggcggcttgggcgtgcgg
ggcctgaaccagccgtccggagggctcggacttgccaccggcgagatgcgcatcgacgtt
ccgtctccatag

DBGET integrated database retrieval system