KEGG   Methanobrevibacter ruminantium: mru_1410
Entry
mru_1410          CDS       T01166                                 
Symbol
ehaC
Name
(GenBank) energy-converting hydrogenase A subunit C EhaC
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mru  Methanobrevibacter ruminantium
Brite
KEGG Orthology (KO) [BR:mru00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    mru_1410 (ehaC)
SSDB
Motif
Pfam: DUF2109 MbhD DUF981 OAD_beta DUF3270
Other DBs
NCBI-ProteinID: ADC47260
UniProt: D3E3Z9
Position
complement(1852968..1853246)
AA seq 92 aa
MYIEIIGVITILMALRAVITKNRAEKLLYINVIGFCVSAIIALYIKTTFGFVLAAAFFIS
STIGSNAIAYSLKDLEDEISYDKDMEERDEEN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgtatatagaaatcataggagttattacaattttaatggctttaagagcagtaataact
aaaaacagagcagaaaagttactttacataaatgtaataggtttctgtgtatctgctatc
attgcattatatattaaaactacatttggctttgtattagctgcagctttcttcatttcc
tctacaatcggttcaaatgcaattgcttatagcttaaaggatttggaagatgagataagc
tatgataaggatatggaagaaagggatgaagagaattaa

DBGET integrated database retrieval system