KEGG   Mycobacterium sp. JS623: Mycsm_01887
Entry
Mycsm_01887       CDS       T02423                                 

Name
(GenBank) methionine synthase II (cobalamin-independent)
  KO
K22363  2-hydroxypropyl-CoM lyase [EC:4.4.1.23]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00625  Chloroalkane and chloroalkene degradation
msa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycsm_01887
Enzymes [BR:msa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.23  2-hydroxypropyl-CoM lyase
     Mycsm_01887
SSDB
Motif
Pfam: Meth_synt_2 Meth_synt_1
Other DBs
NCBI-ProteinID: AGB22266
UniProt: B9VTP0
Position
1868236..1869345
AA seq 369 aa
MKVGSTDVLLPTTMVGNYPNPRWYDGHGFAQFPKGEFVYDAISREAFEDAVLAIVHDQEA
AGLDIISDGKVYGGDSPYASIIYHYYERMSGFRPSGTNIGLPIYSTLYSPIVESEVQREH
PFHLATLRATRKATKKPVKVSYVGIQVLAAAATNNFYSEERELGIAIAKAFKEDFKEIEQ
NGCDIIQLDEFVWPYGIGDWEVDAINYAMEGISCDFWVHTCWGNYSGTPGYLPEENEKEF
GAWVLDKRTSHSAGTERAAAIFPKVLQTNITALNYEVGRTGPDDLKPLLDNNWDRPFVAG
VIDVKSTITETADEVADRIRSVLEFVPAEQLALSTDCGLINLNRMISASKLHALADGAAI
VRAELTRRN
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaaagttgggtcgacagacgtcctgctgcccacgactatggttggcaactatccgaac
ccgcggtggtacgacggacacggattcgctcaattccccaagggggaatttgtctacgac
gcgatcagcagagaagcgtttgaagatgcggttctggctatcgtccacgaccaagaagca
gctggactcgacatcatttccgacgggaaggtctatggcggggactcaccgtacgcatcg
atcatctatcactactacgagcgtatgagcggattcagaccgtcgggaacaaacatcgga
ctgccgatctactccaccctgtactcgccgatcgtggaatccgaagtacaacgcgagcat
cccttccatctagcgacgcttcgagccacccgaaaggcaacgaagaagccagtcaaggtg
tcctacgttggtattcaggtactggccgctgcggcgacgaacaatttttactccgaagaa
cgcgaactgggcatcgcaatcgcgaaggcgttcaaagaggacttcaaagagatcgagcag
aacggctgcgacatcatccaactcgacgagttcgtgtggccctatggcatcggggactgg
gaggtcgatgcgatcaactacgcgatggagggcatcagctgcgacttctgggttcatacc
tgctggggaaactactcgggtacaccagggtatttgccggaggagaatgaaaaggaattc
ggcgcctgggtcctcgacaagaggaccagccactcggccggaactgagcgtgcggcagca
atcttcccgaaggtgctgcaaaccaatatcaccgcattgaactacgaggtgggtcggacc
gggcctgatgatctcaaaccacttctcgacaacaactgggaccgcccgtttgtcgctggt
gtcatcgacgtcaaatcaacgatcaccgaaacagccgacgaggtagccgaccggatcagg
tcggtgctggaatttgtcccggctgagcagcttgcgctgtccacagactgcggattgatc
aacctcaaccggatgatctcggcgagcaaactgcacgcactggccgatggcgcggcgatc
gttcgtgccgaactaaccagacgtaactag

DBGET integrated database retrieval system