KEGG   Mycobacterium sp. JS623: Mycsm_01889
Entry
Mycsm_01889       CDS       T02423                                 

Name
(GenBank) Methane/Phenol/Toluene Hydroxylase
  KO
K22354  alkene monooxygenase beta subunit [EC:1.14.13.69]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00625  Chloroalkane and chloroalkene degradation
msa01100  Metabolic pathways
msa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycsm_01889
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.69  alkene monooxygenase
     Mycsm_01889
SSDB
Motif
Pfam: Phenol_Hydrox
Other DBs
NCBI-ProteinID: AGB22268
UniProt: B9VTP1
Position
1869810..1870862
AA seq 350 aa
MTVNHAVPQREVLSGNRTFTWVTPKGKRPTEYEDLTVGQQSTPAQFAFQGWPVRFDDGRD
PYTAGSTALRSSDWYTYRDPNQTMNRSYIAGVHEAEKALQNTFIGADAAGLFDFAKPEWV
REGLAKHYMTYPFVEYGMFLALCYAEREALSDTVTFSMVFEAADKLRHLQDVVYYSFELA
EAHPDFDDSDSLQVWKEDPVWQGAREAIENVIALDDWMEVVVALNLCFDQLFGELAKIEY
FSRFAGANGDLVTPSVIASSEADTVRTRAWTKELIRHLVEDPEHGAHNRSIISSWIAKWN
TYSVKACDAFAPVFTRAPVQPTTYEDAMAEIRAKQTRYLAEINLESQLVN
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgactgtcaaccacgcggtaccacagcgtgaggtcctttccggaaaccggacctttacg
tgggtgacgccaaaggggaaacgccccaccgagtatgaggatctcaccgtcggccagcag
tccacccccgctcaattcgcattccagggttggccagtccgttttgacgacggtcgcgat
ccttataccgcaggttcgaccgccctgcggtcatccgactggtatacatatcgcgatccg
aatcagacgatgaaccgttcctacatcgccggcgtgcacgaggccgaaaaggctttgcag
aacacgtttatcggcgctgacgcggcgggactgttcgacttcgccaagccggagtgggtg
agggaaggcctcgccaagcactacatgacctacccgttcgtcgagtacggcatgttcctc
gcgttgtgctatgccgagcgagaggcgctgtctgacaccgttaccttctcgatggttttc
gaggctgccgacaaactgcgccacctgcaggacgttgtctactactcgttcgaactggcc
gaggcgcatcctgacttcgacgattccgactcccttcaggtctggaaggaagatccggta
tggcagggagcccgcgaagccatcgagaatgtcatcgctctcgacgactggatggaagtc
gtcgtcgcgttaaatctctgcttcgatcagctgttcggcgaactggcaaagattgagtac
ttctcccgattcgccggcgccaacggcgatttggtgacgccttcggtcatcgcctcttcc
gaggcggacaccgtgagaacgcgtgcgtggacgaaggaactgatacgtcatctcgtcgag
gatcccgagcacggcgcccacaaccgatccatcatcagctcgtggattgcgaagtggaac
acctactccgtgaaggcctgcgatgcgtttgccccggttttcacgcgggccccggtgcag
ccaaccacctacgaggatgcgatggccgagattcgcgccaaacagactcgatacctcgcc
gaaatcaacctcgaatcccaactcgtcaactag

DBGET integrated database retrieval system