KEGG   Mycobacterium sp. JS623: Mycsm_01890
Entry
Mycsm_01890       CDS       T02423                                 

Name
(GenBank) MmoB/DmpM family protein
  KO
K22355  alkene monooxygenase coupling protein
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00625  Chloroalkane and chloroalkene degradation
msa01100  Metabolic pathways
msa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycsm_01890
SSDB
Motif
Pfam: MmoB_DmpM
Other DBs
NCBI-ProteinID: AGB22269
UniProt: L0IU42
Position
1870885..1871214
AA seq 109 aa
MSAPTPSRDRTKVRDTVGISLIGSEETNVAVDMVAELMPDAKITDNDVFYKIERDGLLSF
DMNELSDRLGKPYTVHDFLVNMTTYYGRIVVKDHEIEIHSEILPERFRD
NT seq 330 nt   +upstreamnt  +downstreamnt
gtgtcagcacccacaccctcccgcgaccgcaccaaagttcgtgacaccgttgggatttcg
ttgatcggaagcgaagagaccaacgttgccgtagacatggtcgctgagctgatgccggac
gccaagatcaccgacaacgacgtcttctacaagatcgagcgtgacggtctgctgagcttc
gacatgaacgaactcagcgatcgactcggcaagccctacaccgtccacgacttcctcgtg
aacatgaccacgtactacggccggattgtcgttaaggatcacgagatcgagatccattcg
gagatcctgccggaacgattccgcgactaa

DBGET integrated database retrieval system