KEGG   Mycobacterium sp. JS623: Mycsm_01892
Entry
Mycsm_01892       CDS       T02423                                 

Name
(GenBank) 2-polyprenylphenol hydroxylase-like oxidoreductase
  KO
K22356  alkene monooxygenase reductase
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00625  Chloroalkane and chloroalkene degradation
msa01100  Metabolic pathways
msa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycsm_01892
SSDB
Motif
Pfam: NAD_binding_1 Fer2 FAD_binding_6 NAD_binding_6 Fer2_4 DUF4073
Other DBs
NCBI-ProteinID: AGB22271
UniProt: L0IWD0
Position
1872850..1873902
AA seq 350 aa
MTGEHYTMGDTVTVQPFGETFPVEPGETVLSAILRNGRFVKYGCKHGGCSTCRAEVVEGD
FTQSDGTSFSLSDADRDAGVVLLCSTYPEGDLVVDVSDTMDDLTDEEYNAGQNIVEFTGT
VDRIVDYTHDIAGIEIKLDEPSNITFVPGQYIEVQVPGSDDEWRSFSMANPPSISSRVHL
VVRVIPGGRFTSQVGKEIAEGTTMKLRGPLGQFAIRLSYRPIIFIAGGSGIAPVLSMLAD
LIESNNERPATFLYGARTAADLPMVDKLRELENEHDWFTFIPALSDPDDTPWDGETGLIT
EVLKRHFPSTKGHESYLCGPPAMIDAALDVLTSSGCKDRHIFFDRFVPSG
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgactggagagcactacaccatgggtgacacagtgacggtgcaaccgttcggtgagaca
ttccccgtcgagccgggagagacggtgctgtcggcgatcctgcgcaacggtcgattcgtc
aagtacggctgcaagcacggcggatgcagtacttgccgcgccgaagtggtggaaggcgac
tttacacagagcgacggaacatcgttctcgctcagcgacgccgaccgcgacgccggcgtc
gtgctgctctgctcgacataccccgaaggcgacctcgtcgtcgacgtcagcgacacgatg
gatgacctgaccgacgaggaatacaacgccgggcagaacatcgtcgagttcaccggcacg
gtcgaccggatcgtcgactacacacacgacatcgcgggcatcgagatcaaactggacgaa
ccctcgaacatcacgtttgttcccggccagtatatcgaggtgcaggtgccgggctcagac
gacgagtggcggtcgttctcgatggccaacccgcccagtatcagttcgcgcgtgcacctg
gtggtgcgggtcatccccggtggccgtttcacgtcgcaggtcggcaaggaaatcgccgag
ggtaccacgatgaaactgcggggaccgctcggccagttcgcaattcggttgtcataccgg
ccgatcatcttcatcgccggcggatcgggcatcgccccggtgctttcgatgctcgctgat
ctcatcgagtcgaacaacgagcgcccggccaccttcctctacggcgcgcgcacggccgcc
gacctgccgatggttgacaaacttcgtgaactggaaaacgaacatgactggttcaccttc
attcccgcactgagcgatcccgacgacacgccctgggacggtgaaaccggtctgatcact
gaagttctcaagcgccattttcctagcacgaagggccacgagtcatacctttgcggtcct
cccgccatgatcgacgcggcacttgatgttctgacgagcagcggctgcaaagaccgtcac
atctttttcgaccgctttgtcccgtccggatag

DBGET integrated database retrieval system