KEGG   Mycobacterium sp. JS623: Mycsm_01895
Entry
Mycsm_01895       CDS       T02423                                 

Name
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component
  KO
K22364  2-oxopropyl-CoM reductase (carboxylating) [EC:1.8.1.5]
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mycsm_01895
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.5  2-oxopropyl-CoM reductase (carboxylating)
     Mycsm_01895
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 Pyr_redox K_oxygenase NAD_binding_7 HI0933_like
Other DBs
NCBI-ProteinID: AGB22274
UniProt: L0IU50
Position
1874892..1876547
AA seq 551 aa
MDVRHSSDGFASLRRFIAGTGREIPVGDVGTSDQPLTVGEWSVLVNEFVSNASEEAIWNV
ATPDEDSREYDAIFIGGGAAGRFGSAYLRARGGRQLVIDAWPFLGGSCPHQACVPHHLFS
ECARELDLARTMSGKLWYPQFDPDQARILDVVELFRSGRVFPHAVMNWQSKEQLGLEYVL
NSRARVIDEHTVEADGYRFRAKNIVLCTGARTQLPAIAGTELENVYDFASLVDKLDYEPS
RCVVIGGSKVAVEYASFFQATGCQTTILSRRPVLTSKSLHHVDDGLRDYVVDMMVRRGIT
FEHGVEVLSIEGDRRASSVCFRDGNGSLRQVPCDMVFIATGERPMSAPFVEALGIDVDER
GFITTDRTMRTSVDCVWAAGDLLAGPMEMFKARRTGVTAARNIIGDQHEINLTDYPDFLH
TTYEVTWLGLSEQEARQRYSNVVKIQMPPDRVNPETFPLPAAEGSMLYSFVEPALSGWFK
LVIDGDSRRIVGAHHVGYGAKDAFQYLDYLVRRPEGFTIDEIGELNELYLNPEHFIQLSR
IRAGQAHLEDL
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacgttcggcactccagcgatggattcgcctccctgcgcaggttcatcgcagggacc
ggccgggagatcccagtcggcgatgtgggcaccagtgatcagccgttgacagtcggcgag
tggtcagtcctcgtcaacgagttcgtcagcaacgcaagcgaagaggcgatttggaatgtc
gccacccccgatgaagacagccgcgagtacgatgcgatcttcatcggtgggggagcggcg
ggccgcttcggttcagcctatctgcgtgctcgcggtggccgacaactggttatcgacgca
tggccattccttggcggctcgtgtccccatcaggcctgcgttccccaccacctcttctcc
gaatgtgcacgtgagctcgacctggcacgcaccatgtccggcaagctctggtacccccaa
ttcgatcccgaccaggcgcggatcctcgacgtcgtggaactattcagatccgggcgagtc
ttcccgcacgccgtgatgaactggcaatccaaggaacagctggggttggagtacgtcctt
aacagccgggctcgcgtcatcgacgaacacacggtggaggccgacggctaccgattccgg
gccaagaacatcgtcctgtgcacgggagcacgaacccagttacccgccattgccggaaca
gaactcgagaacgtctacgatttcgcgtcactggtcgacaagctggactatgaacccagt
cgatgcgtggtcatcggcggatccaaggtagccgtcgagtacgcatcgttcttccaggcc
accgggtgccagaccaccatcctgagccgccgtccggttctgacatcgaagtcgctgcac
cacgttgacgatggtctgcgcgattacgtcgtcgacatgatggttcgtcggggaatcacc
ttcgaacacggcgtggaggttctgtccatcgagggcgatcgccgcgcgagcagtgtctgc
ttccgcgacggcaatggatcgctgcggcaagtcccatgcgacatggtgttcatcgccacc
ggcgaacggccgatgtcggcgccatttgtcgaggcattgggcatcgatgtcgacgagcgc
gggttcatcacgaccgatcgaacgatgcggacgtccgtcgactgcgtgtgggcggccggc
gacttgctcgccgggccaatggagatgttcaaggcacgccgcacgggggtaaccgctgcc
cgcaacatcattggcgaccagcacgagatcaacctgaccgactaccccgacttcctccac
acgacctacgaggtcacctggctaggtctgtccgagcaggaggcgcggcaacggtacagc
aatgtcgtgaagatccagatgcctccggaccgcgtcaacccggagaccttcccgctgcca
gcggccgagggatcgatgctgtattcgtttgtcgagcccgcactttcgggctggttcaaa
cttgtgatcgacggtgactcacggcgcatcgtcggcgcccaccatgtgggatacggggcc
aaggatgcgtttcagtacctcgactacctcgtacgccggccagagggcttcaccatcgac
gaaatcggcgagctcaacgagctttacctcaatccagagcatttcattcagctcagccga
attcgcgccgggcaggcacaccttgaagacctctaa

DBGET integrated database retrieval system