KEGG   Methylocystis sp. SC2: BN69_2544
Entry
BN69_2544         CDS       T02324                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K24299  thiocyanate desulfurase [EC:1.8.2.7]
Organism
msc  Methylocystis sp. SC2
Brite
KEGG Orthology (KO) [BR:msc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN69_2544
Enzymes [BR:msc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.2  With a cytochrome as acceptor
    1.8.2.7  thiocyanate desulfurase
     BN69_2544
Motif
Pfam: DUF1513 Ntox37
Other DBs
NCBI-ProteinID: CCJ07995
UniProt: J7QUX0
Position
complement(2637372..2639024)
AA seq 550 aa
MTTDQNFPSEKVASEIAAPQVARAHDQRGRVERREVLRAATAGIIGTILGGKSANATGLF
SRLMGDSASAAEANAPRLATLGDYVWLTPTKLGGGAQVQDLATGKTMAWIEYWNYGDSCP
IAHHLAAFPSADPRKGFEFVNSTQGAQNVLIYGIPTQIREHGMLDPLWGQGNQIYRVGFD
GQQMNLLENVAETTGIGLGVHTVIFPDASGFTVADGQKDVVAFFNRATGNQKTTVIDAFR
FDWRGNEPDGVLEDNWFKGGTVRVSRLVKAPDTGLYDYRGVRGNKLDWEMVPMGEYLAYS
GQLPGDSVKTLTGADNCVHHPIHPLSLVTLRMFAVGVVIDRTTMEPVACISSPDGTTKES
IPVKKIADGIWDIKLDNVVSSGHECGFGPHGKWFTMTNNTRQNSMGVFDCSDRDPRNWKR
VTQFKDSHWVGSTPSPFHITYSMDGSKMFVSELHRKPAKSAIVVVDTNSWTTIKRFENVG
VDLQTMHVTYDGKYVLAIFSGFQRLEGGTFIFTQDTLEPVGYIPNFGGHHDCVIVPRNNE
ELIHSRCTTV
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgactaccgatcaaaacttcccgtcggaaaaagtggcgtcggagatcgccgcgccgcag
gttgcgcgggctcacgatcagcgtggccgggtggaacgccgagaagtgctgcgcgccgcc
acggccggaatcatcgggaccatcttaggcggcaaatccgctaacgcgacagggctgttc
tcacggctgatgggagactcagcgtcggcggcggaggcgaatgcgccgcgtcttgcgacg
ctcggcgactatgtctggctcaccccgacgaagctcggcgggggtgctcaggtgcaggat
cttgcgaccggcaagacaatggcctggatcgaatattggaattatggcgacagctgcccg
atcgcccatcatctcgcggccttcccttcggccgacccgcgcaagggcttcgagttcgta
aactcgactcagggtgcgcagaacgtcctgatttatggcatccccacgcagatccgagaa
catggaatgctcgatcctttgtggggccagggcaatcagatctatcgcgtcggcttcgac
gggcagcagatgaatttgctcgagaatgtcgccgagaccacggggatcggacttggcgtg
cacaccgtcatcttcccggatgcgtctggcttcacggtcgcggacgggcaaaaggatgtg
gtcgccttcttcaatcgcgcgaccggaaaccagaagacgacggtgatcgacgccttccgt
ttcgactggcgtggaaacgagccggacggcgtgctcgaggacaattggttcaagggaggg
accgttcgcgtttcccgtctcgtaaaggcgcctgacaccgggctctatgattatcgcggc
gtcaggggaaacaaactcgattgggagatggtgcccatgggcgagtatctcgcctattcg
ggacagcttccgggcgactcggtgaagacgctgaccggcgccgataattgcgtccaccat
cccatccatccgctctcgctggtgacgcttcgcatgttcgccgtcggcgtcgtcatcgac
cgcacgacgatggagccggttgcgtgcatctcttctccggacggcacgaccaaggaaagc
attccggtcaagaaaatcgccgacggcatttgggacattaagctggataatgtcgtgtcg
tcgggacacgaatgcggttttgggccgcatggcaaatggttcacgatgacgaacaacacc
cgacaaaacagcatgggcgtgttcgattgttcggaccgcgatccgcgcaactggaagcga
gtcacccagttcaaggattcgcactgggtcggctcgacgccgagcccgttccacatcacc
tattcgatggacggctcaaagatgtttgtctccgagctgcatcgcaagccggcgaaaagc
gccatcgtcgtcgtcgacaccaatagttggacgacgatcaagcgcttcgagaacgttggc
gttgacctgcagaccatgcatgtcacctatgacggcaaatatgtgctcgcgatcttcagc
ggattccagcggctcgaaggaggaaccttcatctttacgcaggatacgctggagcccgtc
ggttatatcccgaactttggcggtcaccacgactgcgtcattgttccgcggaacaacgaa
gaattgatccacagccgctgcaccacggtctga

DBGET integrated database retrieval system