KEGG   Mycobacterium senegalense: K3U95_02165
Entry
K3U95_02165       CDS       T07649                                 
Name
(GenBank) aldehyde dehydrogenase family protein
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
msen  Mycobacterium senegalense
Pathway
msen00623  Toluene degradation
msen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msen00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    K3U95_02165
Enzymes [BR:msen01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     K3U95_02165
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: QZA24945
Position
complement(498874..500349)
AA seq 491 aa
MTTLTAPNPYHRFDVMPIGPRWRAGASGRTLTDTNPWDGSTVTEIPLAGLDDVNEAFATA
QAAQADWAATLPEQRAGVLRAAAAILDTRREEILNWLVTETGTPRGKCEVELGVTKAVFL
EAAAMPHHVSGQILPSDIPGKENRVYRQPAGVVALISPWDFPLYLTSRSLAPALAVGNAV
VLKPASDTPVTGGLLLAKIFEEAGLPPGVLSVIVGSGAEIGDAMVEHPIPSIVSFTGSTG
VGIGITQKAGIKRLLMELGGNAPLVVLEDADLDYAVKAATFGSFYNSGQICMIANRIIVD
RSIHDQFVDAFVARVASLKFGDPADPATAIGPVINHNQLASVQAKIASAQQAGAKLILGG
NPIGPTGLTLPPQVLLGTNEVATAKEEVFGPAITIIAADGEDEALKIANDTEYGLSSAVF
TRDINRGVEFALKVKAGMTHVNDSPVNEEDNTAYGGVKQSGLGRFGGTWSIDEFTTHHWV
SVQHTPRDFPF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaccaccttgaccgcccccaacccctaccatcgcttcgacgtgatgcccattggcccc
cgatggcgcgccggcgccagcgggcgcaccctcaccgacaccaacccgtgggacgggtcg
acggtcaccgaaatcccgctggccgggctcgacgacgtcaacgaagccttcgccaccgcc
caagccgcgcaagccgattgggcagcaacactgcccgagcaacgcgccggcgtgctgcgc
gccgcagcggccatccttgacactcgacgcgaggagatcctgaactggctggtcaccgaa
accggcacaccccgcggcaaatgcgaggtagaactgggagtcaccaaggcggtgttcctc
gaggccgcggccatgccgcaccacgtctccgggcagatcctgccctcagacattcccggc
aaagaaaaccgtgtctatcggcagcccgcgggcgttgtcgcgctcatcagcccctgggac
tttccgctgtatctgaccagccggtcgctggcaccggcgttggccgtcggaaacgcggtc
gtcctcaaaccggccagtgacaccccggtcaccggcggcctcctgctggccaagatcttc
gaagaagccggactgcccccaggcgtcttgagcgtcatcgtcggatccggcgccgagatc
ggcgatgccatggtcgagcatcccattccgtccatcgtgtccttcaccggatcaaccggt
gtcggcattggcatcacccagaaggcgggtatcaaacgtctactcatggagctcggcgga
aacgctcccctggttgtactcgaggacgccgacctggactacgccgtcaaagccgccaca
ttcggatcgttctacaactccggccagatctgcatgatcgccaaccgcatcatcgtcgac
cgcagcattcacgatcagttcgtcgacgccttcgtcgcgcgggtcgcatccctgaaattc
ggcgacccagccgaccccgccaccgccatcggcccggtgatcaaccacaaccagctggca
tcggtgcaagccaaaatcgcctccgcccaacaggccggagcaaaactcattctcggcgga
aaccccatcggcccaaccggtttgacattgccgccgcaggtattgctcggcaccaacgag
gtggccaccgcgaaagaagaagtcttcgggcccgccatcaccatcatcgccgccgacggc
gaagacgaggcgctcaagatcgccaacgacaccgagtacggcctgtccagtgcagtgttc
acccgcgacatcaaccgaggtgtggagttcgccttgaaggtcaaggccggcatgacccac
gtcaatgactcaccagtcaacgaagaggacaacaccgcctacggtggcgtcaagcagtcc
gggctcggacgcttcggcggcacctggtccatcgatgagttcactacccaccactgggtc
agcgtgcaacacacgccgcgagacttcccgttctga

DBGET integrated database retrieval system