KEGG   Mycobacterium shinjukuense: MSHI_40740
Entry
MSHI_40740        CDS       T07415                                 

Name
(GenBank) ATP-grasp domain-containing protein
Organism
mshj  Mycobacterium shinjukuense
SSDB
Motif
Pfam: ATP-grasp_4 LAL_C2 ATP-grasp_3
Other DBs
NCBI-ProteinID: BBX76168
UniProt: A0A7I7MV42
Position
4442898..4444181
AA seq 427 aa
MSIHESRRQHLVLVDTYGPSASRLAPAFQAAGYLPIRVQSTPETPRLYRNCPDPFRYTFE
FIHRGSVAETVNAILPFHPVAVIAGCDHGVELADALSEALHPLTGAPTNGTALSAARRDK
YLMIERIKECGLRGARQITVHSEDQLWEWHTRLGGMAILKPLRSAANDGVSWCRTPEDSI
RAFRRLNGRTNVVNLPNDGVVAQEYLIGAEYLVNTVSREGLHHVCDIWKTHRISANGVAD
LVVACHLLPFRGEVQDRLVPYALDVLDALDIRYGAAHIEIKMTPDGPCLVEVGARVAGQD
LPGYTAMATGESQIEWLVDAYTDPDRFRQRHGRPYELVRSVAWALMVAPRSGVLACYRGL
DAIKALESFYEMRLLVQPGQRLHRTIDDSTYPVSLTLMHEVDEILLRDLATLRYLDGEGF
YELTDGP
NT seq 1284 nt   +upstreamnt  +downstreamnt
gtgagcatccacgaaagccgccgccaacacctggttttggtggacacctacgggccgtcg
gcgtctcggctggcgccagcgtttcaggccgccggctacctgcccatcagggtgcaaagc
acacccgagacgccccggctgtaccgcaactgccccgatccgttccgctataccttcgag
ttcatccaccgcggctcggtggcggagacggtgaacgctatcctgccgtttcacccggtc
gcggtcatcgcgggctgcgaccatggtgtcgagctggccgatgcgctcagcgaagccctg
cacccgttgaccggcgcgcccaccaacggcaccgcgctgagcgcggcgcggcgcgacaag
tacctcatgatcgagcggatcaaggaatgcggactgcgcggggctcgacaaatcacggtg
cacagcgaagaccaactgtgggaatggcacacccgcctgggtggcatggccatcctcaaa
ccgctgcgcagcgccgccaatgacggggtcagctggtgtcgcacgcccgaggattccatc
cgggcttttcgccgactcaacggcaggacgaatgtcgtcaacctgcccaacgacggtgtg
gtggcccaggagtacctgatcggcgcggaatacctggtcaacacggtgagtcgggaaggc
ctgcatcacgtctgcgacatctggaaaacacaccgcatcagcgccaacggggtggccgac
ctggtggtggcgtgccacctgttgccgttccgtggggaggtccaggatcggctggtgccc
tacgcccttgatgtgctcgatgccctcgacatccgttacggggcagcgcatatcgagatc
aagatgactcccgacgggccctgcctggtcgaagtcggtgctcgggtcgcaggccaggac
ctgcccggctacaccgccatggcgaccggggaatcccagattgagtggttggtggacgcc
tacaccgaccccgaccggttcaggcaacgccatggccggccctatgagcttgtccgcagt
gtcgcctgggcgctgatggtcgcgccgcgcagcggcgtgctggcctgctaccgcgggttg
gatgccatcaaagcattggaaagtttttatgagatgcggcttttggtgcaacccgggcaa
cggctgcaccgcacgatcgacgacagcacctatccggtgtcgctgacgctgatgcacgag
gtcgacgaaatactccttcgcgaccttgcgacgctgcgctatctcgacggcgaaggcttc
tatgagctcaccgatggcccctag

DBGET integrated database retrieval system