KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_01430
Entry
Mspyr1_01430      CDS       T01376                                 

Name
(GenBank) phthalate 3,4-dihydrodiol dehydrogenase
  KO
K18255  phthalate 3,4-cis-dihydrodiol dehydrogenase [EC:1.3.1.-]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00624  Polycyclic aromatic hydrocarbon degradation
msp01100  Metabolic pathways
msp01120  Microbial metabolism in diverse environments
msp01220  Degradation of aromatic compounds
Module
msp_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mspyr1_01430
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     Mspyr1_01430
SSDB
Motif
Pfam: adh_short adh_short_C2 TrkA_N Epimerase THF_DHG_CYH_C
Other DBs
NCBI-ProteinID: ADT96872
UniProt: E6TIQ4
Position
145236..146039
AA seq 267 aa
MTGWLAGKRALIVGAGSGIGRATVDAFLNEDARVAVLEYDSGKCATLRHQLPDVPVIEGD
GTTRTANDEAVQVAVDAFGGLDTLVNCVGIFDFYRRIQDIPAELIDQAFDEMFRINVLSH
IHSVKAAVPALMGQDGASIVLTESASSFYPGRGGLLYVASKFAVRGVVTALAHELAPRIR
VNGVAPGGTLNTDLRGLDSLDLGARRLDAAPDRARELAARTPLGVALSGEDHAWSYVFLA
SHRSRGLTGETIHPDGGFSLGPPPQRN
NT seq 804 nt   +upstreamnt  +downstreamnt
atgactggctggctggcgggcaaacgcgcgttaatcgtgggagcaggttcgggtatcggt
cgggccacggtcgacgcgttcctgaacgaggatgcccgggtggccgtgctcgagtacgac
agcggtaagtgcgccacgctgcgccatcagctgcccgacgttccggtgatcgagggtgat
gggaccactcgcaccgccaacgacgaagcagtgcaggtcgctgtcgacgccttcggcgga
ctcgacacattggtgaactgcgtggggattttcgatttctaccgccgtattcaggacatc
cccgccgagctgatcgaccaggcgttcgacgaaatgtttcgcatcaacgtcctgagtcat
atccactcagtcaaggcagcagtgccggcgctgatgggccaggacggcgcctcgatcgtg
ctcaccgagtccgcgtcatcgttctatccaggacgcggcggcctgctgtatgtggcgtcg
aagttcgcggtgcgcggcgtagtcactgcactggctcacgaactcgcgccgaggatccgt
gtgaacggtgtcgcccccggggggacgttgaacaccgacctgcgcggactcgacagcctc
gaccttggcgcccgccgtctggatgctgcaccagatcgggcccgcgaattggctgctcgc
acaccgctgggcgtggccctatcgggtgaagaccacgcgtggagttacgtcttcctcgct
tctcaccgctcccgcgggctcaccggcgaaacgatccatcccgacggcggtttcagcctc
ggacccccaccccagcggaattga

DBGET integrated database retrieval system