KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_02040
Entry
Mspyr1_02040      CDS       T01376                                 

Name
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K18257  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase [EC:1.3.1.49]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00624  Polycyclic aromatic hydrocarbon degradation
msp01100  Metabolic pathways
msp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mspyr1_02040
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.49  cis-3,4-dihydrophenanthrene-3,4-diol dehydrogenase
     Mspyr1_02040
SSDB
Motif
Pfam: adh_short adh_short_C2
Other DBs
NCBI-ProteinID: ADT96929
UniProt: E6TJP9
Position
205262..206113
AA seq 283 aa
MSWLTGQVALVTGGAAGIGLAVVERFLAEGACVGVLDRSEGDLATIGNADGRLIAVTGDV
TSYADNVMAVRETVDAFGKLDVFVGNAGIFDYFAPLVGFDGADLSSAFDEIFAVNVKGYL
LGARAAVPELLKSDGPSMIFTVSNSGFYAAGGGPLYTASKHAVVGVVRELAYELAPKIRV
NGVAPGGTVTGLRGIEDLGQGQDVLSSVPGIADIMSTTNPLQYAQQPADHAGLYLLLASA
DNSRAVTGVVINSDGGLGVRGLNQPSGGTELATGAMRIDVGST
NT seq 852 nt   +upstreamnt  +downstreamnt
ttgagttggttgaccgggcaagtcgccctggtgaccggcggggcagccggaatcggtttg
gccgtggtcgagcgtttcttggccgagggcgcatgcgtgggcgtcctggatcgctcggaa
ggcgacctggctaccatcggcaacgccgacggcaggctcatcgcggtaacaggtgacgtg
acgtcgtatgcagacaacgtcatggcggtgcgcgaaacggtcgatgcgttcggaaagctc
gacgtcttcgtcggcaacgctgggatcttcgattactttgcccctttggtgggtttcgac
ggagccgacctcagcagcgccttcgatgagatcttcgcggtcaatgtaaagggctacctc
cttggtgccagggccgccgttcctgaactcctcaaaagcgatggcccgagcatgatcttc
accgtctccaactctggcttctatgccgccggtggcggcccgctgtacaccgcttccaag
cacgcggtcgttggcgtagtgcgtgaactggcctacgagttggcgccgaagatcagggtg
aatggcgtcgctccaggcggcacggtaacgggcctgcgtggaatcgaggacctcggccag
ggtcaggacgtgttgtcatcggtgcccggcatcgccgacattatgagtactacaaaccca
ttgcagtacgcgcagcagcccgccgatcacgccggcctgtatctgctactcgcgtctgca
gacaactcgcgagcggtgaccggcgtcgtcatcaacagcgacggcggcttgggcgtgcgg
ggcctcaaccagccgtccggagggacggaacttgccaccggcgcgatgcgcatcgacgtc
gggtcaacatag

DBGET integrated database retrieval system