KEGG   Methanosarcina siciliae T4/M: MSSIT_0120
Entry
MSSIT_0120        CDS       T03865                                 

Name
(GenBank) ferredoxin
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
msw  Methanosarcina siciliae T4/M
Brite
KEGG Orthology (KO) [BR:msw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MSSIT_0120
Enzymes [BR:msw01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     MSSIT_0120
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4_21 Fer4 Fer4_6 Fer4_7 Fer4_9 Fer4_2 Fer4_10 Fer4_16 Fer4_3 Fer4_4 Fer4_8 CoV_S1_C
Other DBs
NCBI-ProteinID: AKB26839
UniProt: A0A0E3P0J6
Position
149510..151153
AA seq 547 aa
MLQENLKMYGIALDLGTSGFRAQLIDLDTRETLKTVITMGHPLPGGNVMDHLDFAITTGE
NVAHDVIIETVRRMFLKLGADLSKVERLAVCGNPIQLSLFQNIEIRDLAYAGENKQKMLG
VQNVKRESRVFPASELFGNDFHPDCEIIVPPAIRHEIGADALAMMLETDFLTQTEPALVT
DYGTNAEMALKVGDRIITASAAAGPAIEGQGISSGMLASPGAICDVKPEGEYWKILVLDR
EMEKKEAYLINPVSGEIKESNEYEVLGITGTGVISVFALALKSGLVEQLPKLPNGKLILG
PGIEITEKDVEEAGKAIGAIRAAHMTLIVESGIKYEDLEYAYMSGASGAYVDAEAARRLG
AAPGYARKVVQFGNTSLALARELVLDKSRLDDVIEIAKKITADHLMMATSDTFNNFYLCE
LSYWTMGMPLEMYDQMLELYGLPTLPLTLEHADIEKRVSKDIEHVGVGGLAILKEIGIIL
EVPVEKCIYCQKCVKECPENALEIVETDGKRIAKYDSQKCLGTSCRRCVSVCPENAVDIT
KLKIKEK
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgcttcaggagaatctaaaaatgtatggaatagcacttgacctgggtaccagtggtttt
cgagcccagcttattgatcttgatacgcgtgagaccttaaaaacagtcataaccatgggt
catcctctcccagggggaaatgtcatggaccacctggattttgcaatcacgaccggggaa
aatgtggctcatgatgttattatcgaaaccgtcaggaggatgttcctgaaacttggtgcc
gatctttctaaggtggaaaggcttgcagtctgtggaaatcctatccagctttctcttttt
cagaatatcgaaataagagacctcgcatacgccggggaaaataaacagaaaatgctcggg
gtccagaacgtaaaaagggaatcccgggtatttccagcctcagaacttttcggaaacgac
ttccaccctgactgtgaaataatcgtgcctcccgcaatcaggcacgaaatcggggctgat
gcccttgccatgatgctcgaaaccgatttccttacacagacagaacctgcgcttgtgacc
gattatgggacaaatgccgaaatggctctcaaggtaggggacagaattataacggcaagc
gctgcggcaggccctgcaatcgaagggcaggggatcagttccggtatgcttgcaagcccg
ggagcgatttgcgatgtgaagcctgagggtgaatactggaaaattctggtgcttgacagg
gagatggaaaagaaggaagcttacctgatcaaccctgtaagcggcgagataaaagagtct
aacgagtatgaggttttaggcattacgggaacaggggtgatctcggtttttgcccttgca
ctgaaaagcgggctggttgaacagcttcccaagctccccaacggaaaactaattttaggc
cctggaatcgaaattactgaaaaagatgttgaagaagccggaaaagctataggggcaatc
cgggctgctcacatgactctcatagtggaatcaggaatcaagtacgaagaccttgagtat
gcgtacatgtcgggggcttccggagcctatgtagacgccgaagctgcccgccggctcggg
gctgcccctggatatgccagaaaagtcgtacagttcggaaacacctctctcgccctcgcc
cgggaacttgtgctggacaagtccaggctggatgacgttatagagattgcaaaaaagatt
actgccgatcaccttatgatggcaactagcgatactttcaacaacttctacctctgtgaa
ctctcctactggaccatgggcatgcccctcgaaatgtacgaccagatgcttgaactctac
ggcctgcccacacttcccctgaccctcgaacatgctgacatagaaaagagagtaagtaag
gacatagagcatgtcggagttggcggacttgccatcctcaaagaaataggcataatcctc
gaagtcccggtagaaaagtgcatttactgccagaaatgcgtaaaggaatgccctgaaaac
gccctcgagatcgttgaaaccgacggaaaaaggattgcaaagtacgacagccagaaatgc
ctcggcacaagctgccggcgctgtgtcagtgtctgccctgaaaatgctgtcgatattaca
aaactcaaaataaaggaaaaatga

DBGET integrated database retrieval system