KEGG   Methanosarcina siciliae HI350: MSSIH_0116
Entry
MSSIH_0116        CDS       T03864                                 

Name
(GenBank) ferredoxin
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
msz  Methanosarcina siciliae HI350
Brite
KEGG Orthology (KO) [BR:msz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MSSIH_0116
Enzymes [BR:msz01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     MSSIH_0116
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4_21 Fer4 Fer4_6 Fer4_7 Fer4_9 Fer4_2 Fer4_10 Fer4_16 Fer4_3 Fer4_4 Fer4_8 CoV_S1_C
Other DBs
NCBI-ProteinID: AKB30806
UniProt: A0A0E3L9T0
Position
144869..146539
AA seq 556 aa
MVPGFSGRFMLQENLKMYGIALDLGTSGFRAQLIDLDTRETLKTVITMGHPLPGGNVMDH
LDFAITTGENVAHDVIIETVRRMFLKLGADLSKVERLAVCGNPIQLSLFQNIEIRDLAYA
GENKQKMLGVQNVKRESRVFPASELFGNDFHPDCEIIVPPAIRHEIGADALAMMLETDFL
TQTEPALVTDYGTNAEMALKVGDRIITASAAAGPAIEGQGISSGMLASPGAICDVKPEGE
YWKILVLDREMGKKEAYLINPVSGEIKESNEYEVLGITGTGVISVFALALKSGLVEQLPK
LPNGKLILGPGIEITEKDVEEAGKAIGAIRAAHMTLIVESGIKYEDLEYAYMSGASGAYV
DAEAARRLGAAPGYARKVVQFGNTSLALARELVLDKSRLDDVIEIAKKITADHLMMATSD
TFNNFYLCELSYWTMGMPLEMYDQMLELYGLPTLPLTLEHADIEKRVSKDIEHVGVGGLA
ILKEIGIILEVPVEKCIYCQKCVKECPENALEIVETDGKRIAKYDSQKCLGTSCRRCVSV
CPENAVDITKLKIKEK
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggtgccgggcttctcgggacggtttatgcttcaggagaatctaaaaatgtatggaata
gcacttgacctgggtaccagtggttttcgagcccagcttattgatcttgatacgcgtgag
accttaaaaacagtcataaccatgggtcatcctctcccagggggaaatgtcatggaccac
ctggattttgcaatcacgaccggggaaaatgtggctcatgatgttattatcgaaaccgtc
aggaggatgttcctgaaacttggtgccgatctttctaaggtggaaaggcttgcagtctgt
ggaaatcctatccagctttctctttttcagaatatcgaaataagagacctcgcatacgcc
ggggaaaataaacagaaaatgctcggggtccagaacgtaaaaagggaatcccgggtattt
ccagcctcagaacttttcggaaacgacttccaccctgactgtgaaataatcgtgcctccc
gcaatcaggcacgaaatcggggctgatgcccttgccatgatgctcgaaaccgatttcctt
acacagacagaacctgcgcttgtgaccgattatgggacaaatgccgaaatggctctcaag
gtaggggacagaattataacggcaagcgctgcggcaggccctgcaatcgaagggcagggg
atcagttccggtatgcttgcaagcccgggagcgatttgcgatgtgaagcctgagggtgaa
tactggaaaattctggtgcttgacagggagatgggaaagaaggaagcttacctgatcaac
cctgtaagcggcgagataaaagagtctaacgagtatgaggttttaggcattacgggaaca
ggggtgatctcggtttttgcccttgcactgaaaagcgggctggttgaacagcttcccaag
ctccccaacggaaaactaattttaggccctggaatcgaaattactgaaaaagatgttgaa
gaagccggaaaagctataggggcaatccgggctgctcacatgactctcatagtggaatca
ggaatcaagtacgaagaccttgagtatgcgtacatgtcgggggcttccggagcctatgta
gacgccgaagctgcccgccggctcggggctgcccctggatatgccagaaaagtcgtacag
ttcggaaacacctctctcgccctcgcccgggaacttgtgctggacaagtccaggctggat
gacgttatagagattgcaaaaaagattactgccgatcaccttatgatggcaactagcgat
actttcaacaacttctacctctgtgaactctcctactggaccatgggcatgcccctcgaa
atgtacgaccagatgcttgaactctacggcctgcccacacttcccctgaccctcgaacat
gctgacatagaaaagagagtaagtaaggacatagagcatgtcggagttggcggacttgcc
atcctcaaagaaataggcataatcctcgaagtcccggtagaaaagtgcatttactgccag
aaatgcgtaaaggaatgccctgaaaacgccctcgagatcgttgaaaccgacggaaaaagg
attgcaaagtacgacagccagaaatgcctcggcacaagctgccggcgctgtgtcagtgtc
tgccctgaaaatgctgtcgatattacaaaactcaaaataaaggaaaaatga

DBGET integrated database retrieval system