KEGG   Methanothermobacter thermautotrophicus: MTH_1249
Entry
MTH_1249          CDS       T00009                                 
Name
(GenBank) conserved protein
  KO
K14112  energy-converting hydrogenase B subunit C
Organism
mth  Methanothermobacter thermautotrophicus
Brite
KEGG Orthology (KO) [BR:mth00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    MTH_1249
SSDB
Motif
Pfam: PhaG_MnhG_YufB DUF2109
Other DBs
NCBI-ProteinID: AAB85738
UniProt: O27317
Position
complement(1143103..1143366)
AA seq 87 aa
MYLIIMKSAVLFISSILVILAALGILRFRDNVERVLYARIHILGIADVACILALLALGEP
LLAATYFILAPFVSHAIANAHHYGEGD
NT seq 264 nt   +upstreamnt  +downstreamnt
atgtatctgataatcatgaaatcagcggttctcttcatatcatccatactcgtgatacta
gcagccctggggatactcaggttcagggataacgtcgagcgtgtcctgtatgccaggatc
catatcctgggaatagctgacgtggcatgcatactcgcccttcttgcactcggcgagcca
ctactggcagccacctacttcatactggcacccttcgtgtcccatgcaatagccaacgcc
caccactacggggagggagattag

DBGET integrated database retrieval system