KEGG   Methanothermobacter thermautotrophicus: MTH_386
Entry
MTH_386           CDS       T00009                                 
Name
(GenBank) unknown
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mth  Methanothermobacter thermautotrophicus
Brite
KEGG Orthology (KO) [BR:mth00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    MTH_386
SSDB
Motif
Pfam: DUF2109 DUF6541 PhrC_PhrF
Other DBs
NCBI-ProteinID: AAB84892
UniProt: O26486
Position
331096..331356
AA seq 86 aa
MLIMLIQITGIIVVLMALRTLLAQDRAERLLYLNAMSFGISAMIALYVGTAFGAVLATVY
FVASTITSNAIAHTLDRVGEEMVIED
NT seq 261 nt   +upstreamnt  +downstreamnt
gtgttaatcatgttgatccagataacagggataatagtggtgctcatggccttgaggaca
ctcctggcccaggacagggctgagaggctcctctacctcaatgccatgtcctttggaata
tctgcaatgatagccctctacgttggaaccgcctttggcgctgtccttgcaacggtatac
tttgtggcatcaaccataacatccaatgcaatcgcccacacccttgaccgtgttggagag
gaaatggttatcgaggattag

DBGET integrated database retrieval system