KEGG   Methanosarcina thermophila CHTI-55: MSTHC_1353
Entry
MSTHC_1353        CDS       T03891                                 

Name
(GenBank) ferredoxin
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mthe  Methanosarcina thermophila CHTI-55
Brite
KEGG Orthology (KO) [BR:mthe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MSTHC_1353
Enzymes [BR:mthe01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     MSTHC_1353
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4_21 Fer4_6 Fer4 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_2 Fer4_4
Other DBs
NCBI-ProteinID: AKB15671
UniProt: A0A0E3NF31
Position
complement(1673855..1675477)
AA seq 540 aa
MYGIALDLGTSGFRAQLIDLETKETLKTVITMGHPLPGGNVMDHLDFAITTGEDVAHAVI
LETIRRMFRKFDVDLSKVERLAVCGNPIQLSLFQNMEIRDLAYAGENKQKKLGVQNVKRD
ARIFPASEIFVEKDLPNCEIIVPPAIKHEIGADALAMMLETDFLTQPEISLVTDYGTNAE
MALKIGDRIITASAAAGPAIEGQGISSGMLASPGAICDVKPEGEYWRIMVLDRGMEKRNA
YIIHPVTGEIKESFGYEAAGITGTGVISAFALALKSGLMEKPPKLPNGKLILGPGIEITE
KDVEEAGKAIGAIRAAHLTMIVESGIKYEDLEYAYMSGASGAYVDAEDARRLGAAPGYAK
RIVQFGNTSLALARELVLDKSRLDYVISIARKITANHLMMATSETFNNFYLCELSYWTMG
MPLEMYNEMLELYGLPPLPKTLEHVSIEKRVSKDIEQVGSGGLTILKEIGIILEVPVEKC
IYCKKCVQECPEAALEILEIDDKRVAKYDSQKCLGTSCRRCVAVCPESAIDVTKLKIKAK
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtatggaatagcccttgatctgggtaccagcggctttagagcccagcttatcgacctt
gaaacgaaagaaacactaaaaacggtaataaccatgggacacccccttccagggggaaat
gttatggaccacctggactttgcaattacaacaggcgaagacgtggctcatgcggtaatt
cttgaaactatcagaaggatgtttcggaaattcgatgttgacctttctaaggtagaacgg
ctggctgtatgtggaaatcctattcagttatcccttttccagaatatggaaataagggat
ctggcttatgcaggtgaaaataagcaaaaaaagcttggagtacaaaatgtaaaaagagac
gcccgtatttttcctgcttctgagatttttgtagaaaaagacctgcccaattgtgagatt
attgtgcctcctgcaattaaacatgagattggagctgacgccctagcaatgatgcttgag
accgacttccttactcagcccgaaatctcacttgttacggattatgggacgaatgccgaa
atggctcttaaaataggggacagaattatcacagcaagcgcggcagccgggcctgcaatt
gaaggacagggaataagctcaggcatgctcgcaagccctggcgcgatctgtgacgtaaaa
cctgaaggtgagtactggagaattatggttcttgacaggggaatggaaaagaggaatgct
tacattatccatccggttacaggggaaataaaagaatctttcggctacgaggccgcaggg
attacgggtacaggcgttatatcggcttttgcgcttgcgctgaaaagcggactcatggaa
aaacctcctaaacttccaaatggaaaactgattcttggcccaggaattgagatcactgaa
aaggatgtggaggaagccggaaaagctataggggcgatccgtgctgctcatctgaccatg
attgttgagtccgggattaagtacgaagatcttgagtatgcgtatatgtcaggagcttcg
ggagcctatgtggatgctgaagatgctcgcagacttggagctgccccaggctatgcaaag
agaattgtccagttcggaaatacctcgcttgcacttgctagggaacttgtgctggataag
tccagactggattatgtaatcagcattgcaagaaaaattactgccaatcatctcatgatg
gcaactagcgagaccttcaacaacttctatctctgtgaactttcctactggaccatggga
atgccccttgagatgtacaatgagatgcttgaactctatggtctgcctcctcttccaaaa
actctcgaacacgtaagcatcgaaaagcgagttagtaaagacatcgaacaggtaggatca
ggggggcttaccattctcaaagaaataggcataatccttgaagtccctgtggaaaaatgt
atctattgtaaaaaatgtgtacaagaatgccctgaggctgctcttgaaatcctcgaaatc
gacgataaaagggttgcaaaatatgacagtcagaaatgtctgggcacaagctgccgccgc
tgtgttgctgtctgccccgaaagtgccatcgatgtaacaaaactcaaaatcaaagcaaaa
taa

DBGET integrated database retrieval system