Methanothermobacter sp. THM-1: FZP57_05045 Help Entry FZP57_05045       CDS       T06420                                  Name (GenBank) ribonuclease P   KO K03537   ribonuclease P/MRP protein subunit POP5 [EC:3.1.26.5] Organism mthm  Methanothermobacter sp. THM-1 Pathway mthm03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:mthm00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     FZP57_05045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:mthm03009]     FZP57_05045    03016 Transfer RNA biogenesis [BR:mthm03016]     FZP57_05045    03029 Mitochondrial biogenesis [BR:mthm03029]     FZP57_05045 Enzymes [BR:mthm01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      FZP57_05045 Ribosome biogenesis [BR:mthm03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      FZP57_05045 Transfer RNA biogenesis [BR:mthm03016]  Eukaryotic type   5'processing factors    Ribonucrease P     FZP57_05045 Mitochondrial biogenesis [BR:mthm03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     FZP57_05045 SSDB OrthologParalogGFIT Motif Pfam:  RNase_P_Rpp14 Motif Other DBs NCBI-ProteinID:  QHN07225 Position complement(976413..976787) Genome browser AA seq 124 aa AA seqDB search MKILPPTLRNPRRYIAFELISEKELGRDEIISVIWESCLRLHGECETSNFRLWLMKLWSF DFPDAVMTLGVLQCQRGYEGKVMAALTSAHHHGGKRLAFHVLGISGTIRSATQKFIKPLD KDKY NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgaagatactcccgccgacactgagaaaccccagaaggtacattgccttcgaacttatc agtgagaaggaacttggaagggatgaaataatatccgtgatctgggagagctgcctgagg ctccacggtgaatgtgaaacatcaaatttcaggctgtggctcatgaagctctggagtttc gattttcccgacgcggttatgaccctgggtgttctccagtgccagaggggatacgagggg aaggtgatggctgcacttacctctgcacaccaccatggcgggaagaggctggccttccat gtgctcggcatctcagggaccatacgctccgcaacacaaaagtttattaaacctttggat aaagataaatactga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (1) Pfam (1) All databases (3) Download RDF

DBGET integrated database retrieval system