KEGG   Medicago truncatula (barrel medic): MTR_3g063120
Entry
MTR_3g063120      CDS       T01716                                 

Name
(GenBank) (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
mtr  Medicago truncatula (barrel medic)
Brite
KEGG Orthology (KO) [BR:mtr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MTR_3g063120
Enzymes [BR:mtr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     MTR_3g063120
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-ProteinID: KEH34550
UniProt: A0A072V8N2
Position
3
AA seq 495 aa
MESFYLMDIIQRFGIEHYFAEEIKVALENLHLILNTNPIIDFVSSHELYEVALAFRLLRQ
GGHYVNADLFDSLKCNKRMFEEKHGEDVKGLIALYEASQLSIEGEDSLNDVGYLCCELLH
AWLSRNQEHKDALYVANTLQNPLHYGLSRFMDKNTFMHDLKAEKDLICLEELAKINSGIV
RFMNQNETIEVSKWWKELGLDKEVKFSGYQPLKWYTWPMACFTDPNFSEQRIELTKPISL
IYVIDDIFDVHGTLDQLTIFTDAINRWETTGTEQLPNFMKISLNALYDITNKFAENVYKK
HGFNPIDTLKKSWIRLLNAFMEEAHWLNSGHLPKAEDYLNNGIVSTGVHVVLEHAFFLLD
HVSGITKETIDILDENFPNVIYSVAKILRLSDDLEGAKSGDQNGLDGSYLDCYMSEHQDI
SSEDVQRHVAHMISNEWKCLNQEILVTNQFSSSFSNFCLNAARMVPLMYHYKSNPSLSNL
QEHVNSLINVSVGCN
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggagagtttttatttgatggatattatccaaaggtttggtattgagcactattttgct
gaggaaataaaagtggctcttgaaaatctgcatttgatattgaacaccaatcctataatt
gattttgtgagtagccatgaactctatgaagttgcacttgcattccgcttgctgagacaa
ggaggccattacgtaaatgcagatttatttgacagcttgaagtgtaacaaaagaatgttt
gaagaaaaacatggtgaggatgtgaaaggtctcattgccctttacgaagcatcgcaacta
agtattgaaggagaagatagtcttaacgatgtaggatatctctgctgtgagcttctacat
gcatggttgtcaagaaaccaagaacataaggatgctttatatgttgcaaacactcttcag
aatccacttcactatggattgtcaagatttatggataaaaacacattcatgcatgatttg
aaggctgagaaggatttgatatgtttagaggaacttgctaaaatcaattctggcatagtt
aggttcatgaaccagaatgaaaccattgaagtttccaaatggtggaaagaacttggacta
gacaaggaggtgaagttttcagggtatcaacctctgaaatggtacacatggcctatggca
tgctttacagatccaaacttttcagaacaaaggattgagctcacaaaacccatctcttta
atttatgttattgacgacattttcgatgttcacgggacattggatcaacttacaatattc
acagatgctattaacaggtgggaaaccactggcacagagcaacttccaaacttcatgaaa
atatctttgaatgcactttacgacattaccaataaatttgctgaaaatgtctacaagaag
catggatttaaccctatagacacactcaaaaaatcgtggatacgcttattgaacgctttc
atggaagaggctcattggttgaattctggtcacttaccaaaagcagaggattacttaaac
aatggaatagtgagcactggagtgcatgttgtgcttgaacatgcattcttccttttggat
catgttagtggtataacaaaggagacaattgatatcttggatgaaaatttcccaaatgtt
atatattcagtggcaaaaattcttcgtctctctgatgatttagaaggagctaagagtgga
gatcaaaatggtcttgatgggtcataccttgattgctacatgagtgaacaccaagatatt
tccagtgaagacgtgcaacgacatgttgctcacatgatttcaaatgaatggaaatgtctc
aatcaagaaattctggtcacaaatcagttttcatcatcattttccaatttttgtctcaat
gctgctagaatggttcccctcatgtaccactataagagcaacccgagcctctctaatctc
caggaacatgttaactcattgattaatgttagtgttgggtgcaattag

DBGET integrated database retrieval system