KEGG   Musa acuminata (wild Malaysian banana): 103976634
Entry
103976634         CDS       T03447                                 

Definition
(RefSeq) curcumin synthase 2
  KO
K13234  curcumin synthase [EC:2.3.1.217]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
mus00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
mus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mus00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    103976634
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:mus01008]
    103976634
Enzymes [BR:mus01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.217  curcumin synthase
     103976634
Polyketide biosynthesis proteins [BR:mus01008]
 Polyketide synthase (PKS)
  Type III PKS
   Plant type
    103976634
SSDB
Motif
Pfam: Chal_sti_synt_N Chal_sti_synt_C ACP_syn_III_C ACP_syn_III DUF2286 FAE1_CUT1_RppA
Other DBs
NCBI-GeneID: 103976634
NCBI-ProteinID: XP_009390182
Position
2
AA seq 389 aa
MASLHALRKTQRAQGPATIMAIGTANPPNLYEQSTYPDYYFRVTNSEHKPDLKHKFRRMC
EKTMVKRRYLHLTEEILKERPKLCSYMEPSFDDRQDIVVEEVPKLAKEAATKAIKEWGRS
KSDITHLVFCSISGIDMPGADYRLAKLLGLPLSVNRIMLYSQACHMGAAMLRIAKDLAEN
NKGARVLVVSCEITVLSFRGPDEHDFEALAGQAGFGDGAAAVIVGADPIQGLEKPIYEIM
SATQVTVPESEKAVGGHLREVGLTFHFFNQLPLIIADNIGNSLADAFKPLGITDWNEVFW
VAHPGNWAIMDAIESKLGLLPEKLSTARHVFTEYGNMQSATVYFVMDEVRKRSVVEGRAT
TGDGLQWGVLFGFGPGLSIETVVLRSVPL
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggccagcctccacgctctgcgcaagacacagagggctcagggtccggccaccatcatg
gccatcggcaccgccaaccctcccaacctctacgaacagagcacctatcccgactactac
ttccgcgtcaccaactctgagcacaagccggatctcaagcacaagtttcggcgcatgtgc
gagaagacgatggtcaaacggcgctacctgcatctcaccgaggagatcctcaaggagaga
ccaaaactgtgctcctacatggagccatccttcgacgaccggcaggacatcgtggtggag
gaggtgcccaagctggccaaggaagccgccaccaaggccatcaaggagtggggccgctcc
aagtccgacatcacccacttggtcttctgctccatcagcggaatcgacatgcccggcgcc
gactaccgccttgccaaactcctcggcctcccgttgtccgtcaaccgcatcatgctctac
agccaggcctgccatatgggcgccgccatgctccgcatcgccaaggacctcgccgagaac
aacaagggggctcgtgtgctcgtggtgtcctgcgagatcaccgtcctcagcttccgaggc
ccggacgagcacgacttcgaggccctcgctggccaagcggggttcggtgacggagcagct
gcggtcatcgtgggtgccgatccgatccaaggcctggagaagccgatctacgagataatg
tcggccacgcaagtaacggtgccagagagcgagaaggccgtgggaggccacctccgggag
gtcggcctgaccttccacttcttcaaccagctgcccctgatcatcgccgacaacatcggg
aacagcctcgcggacgcattcaagcccttgggcatcaccgactggaacgaggtgttctgg
gtggcgcacccgggaaattgggccatcatggacgccatcgagtccaagctggggctcctg
ccggagaagctcagcacagcacgtcatgtattcaccgagtacggcaacatgcagagcgcc
accgtgtatttcgtgatggatgaggtgaggaagcggtcggtggtggaggggcgggcgacc
accggggatggactgcagtggggggtgctctttgggtttggaccggggctcagcatcgag
actgtcgtgctccgcagcgtaccactctaa

DBGET integrated database retrieval system