KEGG   Mycolicibacterium vanbaalenii: Mvan_0466
Entry
Mvan_0466         CDS       T00449                                 

Name
(GenBank) phthalate 3,4-dihydrodiol dehydrogenase
  KO
K18255  phthalate 3,4-cis-dihydrodiol dehydrogenase [EC:1.3.1.-]
Organism
mva  Mycolicibacterium vanbaalenii
Pathway
mva00624  Polycyclic aromatic hydrocarbon degradation
mva01100  Metabolic pathways
mva01120  Microbial metabolism in diverse environments
mva01220  Degradation of aromatic compounds
Module
mva_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mva00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mvan_0466
Enzymes [BR:mva01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     Mvan_0466
SSDB
Motif
Pfam: adh_short adh_short_C2 TrkA_N Epimerase NAD_binding_7
Other DBs
NCBI-ProteinID: ABM11313
UniProt: A1T2B3
Position
507570..508373
AA seq 267 aa
MTGWLAGKRALIVGGGSGIGRATVDAFLNEDARVAVLEYDSGKCATLRHQLPDVPVIEGD
GTTRTANDEAVQVAVDAFGGLDTLVNCVGIFDFYRRIQDIPAERIDQAFDEMFRINVLSH
IHSVKAAVPALMGQDGASIVLTESASSFYPGRGGLLYVASKFAVRGVVTALAHELAPRIR
VNGVAPGGTLNTDLRGLDSLDLGARRLDAAPDRARELAARTPLGVALSGEDHAWSYVFLA
SHRSRGLTGETIHPDGGFSLGPPPQRN
NT seq 804 nt   +upstreamnt  +downstreamnt
atgactggctggctggcgggcaaacgcgcattgatcgtcggcggaggttcgggtatcggt
cgggccacggtcgacgcgttcctgaacgaggatgcccgggtggccgtgctcgagtacgac
agcggtaagtgcgccacgctgcgccatcagctgcccgacgttccggtgatcgagggcgat
gggaccacccgcaccgccaacgacgaagcagtgcaggtcgctgtcgacgccttcggcgga
ctcgacacattggtgaactgcgtggggattttcgatttctaccgccgtattcaggacatc
cccgccgagcgaatcgaccaggcgttcgacgaaatgtttcgcatcaacgtcctgagtcat
atccactcagtcaaggcagcagtgccggcgctgatgggccaggacggcgcctcgatcgtg
ctcaccgagtccgcgtcatcgttctatccaggacgcggcggcctgctgtatgtggcgtcg
aagttcgcggtgcgcggcgtagtcactgcactggctcacgaactcgcgccgaggatccgt
gtgaacggtgtcgcccccggggggacgttgaacaccgacctgcgcggactcgacagcctc
gaccttggcgcccgccgtctggatgctgcaccagatcgggcccgcgaattggctgcccgc
acaccgctgggcgtggccctatcgggtgaagaccacgcgtggagttacgtcttcctcgct
tctcaccgctcccgcgggctcaccggcgaaacgatccatcccgacggcggtttcagcctc
ggacccccaccccagcggaattga

DBGET integrated database retrieval system