KEGG   Methanococcus voltae: Mvol_1589
Entry
Mvol_1589         CDS       T01251                                 
Name
(GenBank) Protein of unknown function DUF2109, membrane
  KO
K14094  energy-converting hydrogenase A subunit C
Organism
mvo  Methanococcus voltae
Brite
KEGG Orthology (KO) [BR:mvo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Mvol_1589
SSDB
Motif
Pfam: DUF2109 DUF4131
Other DBs
NCBI-ProteinID: ADI37244
UniProt: D7DQW7
Position
1787188..1787478
AA seq 96 aa
MESLVILTIGFIGIICVARIFLTKSRALKLPILCCLNFAVAALIALYINSPMGALVSIIY
FVFATLSSNAIAHTIGELDKFQDIDKFEKDDDEFFK
NT seq 291 nt   +upstreamnt  +downstreamnt
atggaaagcttagtaattctaacaataggatttatcgggataatttgtgtcgcaaggata
ttcttaacaaaaagtagggctttaaaattgccaatactttgttgtttaaactttgctgtt
gcagcattaattgcattgtacataaattccccaatgggtgcgttagtgtccataatttac
tttgtatttgctacattatcaagtaatgcgatagctcatacaataggtgaattagataaa
tttcaagatattgataaattcgaaaaagacgatgatgaattttttaaataa

DBGET integrated database retrieval system