KEGG   Methanocaldococcus vulcanius: Metvu_0792
Entry
Metvu_0792        CDS       T01105                                 

Definition
(GenBank) deoxycytidine triphosphate deaminase
  KO
K09887  dCTP deaminase (dUMP-forming) [EC:3.5.4.30]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
mvu00240  Pyrimidine metabolism
mvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Metvu_0792
Enzymes [BR:mvu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.30  dCTP deaminase (dUMP-forming)
     Metvu_0792
SSDB
Motif
Pfam: dUTPase DCD
Other DBs
NCBI-ProteinID: ACX72650
UniProt: C9RGE8
Position
complement(762415..763023)
AA seq 202 aa
MILSDKDILEYIELGKLVIEPFNEKFVGPCSYDVTLGGEFIIYRDEVYDLSKELNYEEIK
IKHSILVCPLNFQLCDDKIDYFKERYGVDHVVKGGILGTTNEYIELPNDISAQYQGRSSL
GRVFLTSHQTAGWIDAGFKGKITLEIAAFDKPVILYKDQRIGQLIFSKLLSPANVGYSER
KSSKYKYQKTVVPSLIHNDFKD
NT seq 609 nt   +upstreamnt  +downstreamnt
atgattcttagtgataaagatatattggaatatatagaattaggaaaacttgttatagaa
ccttttaatgaaaaatttgttgggccgtgtagttatgatgttacgttgggaggagaattt
attatttatagggatgaggtttacgatttatcaaaggaactaaattatgaagaaataaaa
ataaaacattctattttggtctgtcctctaaattttcagttatgcgatgataagatcgat
tattttaaagagagatatggtgttgatcatgtagtaaaaggaggaattttaggaactaca
aatgaatatatagaactaccaaatgatatttctgcacagtatcagggaaggagtagttta
ggaagagtttttttaacatcccatcaaaccgctggatggatcgatgcaggatttaaaggg
aaaataacattagaaattgctgcatttgacaaaccagttattttatataaagatcagcga
attgggcagttaatttttagtaagttattgtctcctgcaaatgttggttattctgaaaga
aagtcctcaaaatataagtatcaaaaaacagttgttccatctttgatccataacgatttt
aaagattaa

DBGET integrated database retrieval system