KEGG   Methanosalsum zhilinae: Mzhil_0453
Entry
Mzhil_0453        CDS       T01541                                 

Name
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mzh  Methanosalsum zhilinae
Brite
KEGG Orthology (KO) [BR:mzh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mzhil_0453
Enzymes [BR:mzh01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     Mzhil_0453
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4_6 Fer4_9 Fer4_21 Fer4_7 Fer4 Fer4_10 Fer4_17 Fer4_16 Fer4_8 Fer4_2 Fer4_4
Other DBs
NCBI-ProteinID: AEH60327
UniProt: F7XPQ7
Position
502710..504332
AA seq 540 aa
MYGIALDLGTSGFRAQLIDLENKETVKTVITMNHPLPGGNVMDHLDFAIQSGPDIAHGII
IETIEKIFLKFDRDLSKIERLAVCGNPIQLSLFQNMEIRDLAYAGKSKQKKLGVENVKRE
ARIFPADELFNRDVKLPNAEIIIPPAIKHEIGADALAMMIKTDFMNQQEISLVTDYGTNA
EMALKIGDRIITGSAAAGPAIEGQGIDCGMLASPGAISNVNEEDGVWRLTVLNERMEEKK
GYLIDPVTGEIRDEGEVKPKGITGTGVIAAISLAVNTGIIKKLPHLPNGKLILGEDIVLR
DKDIEEAGKAIGAIRAAHLALLVESGVKYEDLKNMYMSGASGTYVDADKARKIGLVPNFS
KKIVQFGNTSIALAKDLVMDSSKLDEISEIASRITADHLMMAKSSTFTDIYLSELSYWTH
GMPLEMYNEMLEMYNIPKPPEIFQNPVIERRMVKDISDVGKEGIDIVREIGTVITEVTDG
CIFCHKCETECPEDAITIVERNGELIAEYSTEKCLGTSCRRCVAICPESAIHYKDIQIKR
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgtatggcattgcactggatctgggaacaagcggttttcgtgctcagttgatagacctt
gagaataaagaaactgtaaaaacagtaattaccatgaaccatccattacctggaggaaat
gtgatggatcatctggattttgcgatccagtcaggtccggatattgctcacggaataata
attgaaactatagaaaaaatttttctaaaatttgaccgggatctatcaaagattgaaagg
ctggcagtatgtggaaatcctatccagttatcattattccagaatatggaaataagggat
cttgcctatgcaggtaaaagcaaacagaaaaaacttggagttgagaatgtaaaaagggag
gcacggatttttccagccgatgaactgtttaacagggatgtaaaacttccaaatgctgaa
ataataattcctccagccatcaagcacgagattggtgcagatgcccttgccatgatgatc
aagaccgatttcatgaatcagcaggaaatttcacttgtaactgattatggaaccaatgcg
gaaatggccttaaagattggagatcgcatcataacaggcagtgctgctgcagggcctgca
attgaaggccaggggatagactgtgggatgctggcaagtccgggtgcgatatccaatgtg
aatgaggaggatggtgtatggagactcactgtgctcaacgagcgcatggaagagaaaaaa
ggatacctgatagatcctgtaacaggtgagatcagagatgaaggagaagtaaagcctaaa
ggaatcaccggaaccggtgtcattgctgcgatctcactggcagtgaatacaggaattata
aaaaaattacctcacctacccaatggaaagctgatacttggagaagatattgttctaagg
gataaggatattgaggaagcaggtaaggcaataggtgcaataagagctgctcacctggca
ttgcttgtggaatccggagtcaaatatgaggatctcaagaacatgtatatgtccggtgct
tcaggtacatatgtggatgcagataaagcccgcaaaatagggcttgttccaaatttttcg
aaaaagatagttcagtttggaaatacttcaatagcacttgcaaaggatcttgttatggat
tcttcaaaacttgatgagatcagtgaaatagccagcaggataactgcagatcatttgatg
atggcaaaaagcagtacatttacggacatatacctatctgaactctcatactggacacat
ggaatgccccttgaaatgtataatgagatgctggaaatgtacaatattccaaaaccacct
gagatttttcaaaatccagtgatcgaaagaaggatggtcaaagatatttcagatgttggt
aaagaaggtatagatatagttagggaaatcggtactgtgattactgaggttacagatggt
tgtatcttttgccataaatgcgaaaccgaatgccctgaggatgccataaccatcgttgaa
cgaaatggtgaactcatagctgaatattctacagaaaaatgccttggtacaagctgcagg
cggtgtgtggctatatgtccagaaagtgctatacattacaaggatatccagataaaaaga
tga

DBGET integrated database retrieval system