KEGG   Methanolobus zinderi: HWN40_00990
Entry
HWN40_00990       CDS       T06665                                 

Name
(GenBank) methylamine methyltransferase corrinoid protein reductive activase
  KO
K16183  [Co(II) methylated amine-specific corrinoid protein] reductase [EC:1.16.99.1]
Organism
mzi  Methanolobus zinderi
Brite
KEGG Orthology (KO) [BR:mzi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HWN40_00990
Enzymes [BR:mzi01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.99  With unknown physiological acceptors
    1.16.99.1  [Co(II) methylated amine-specific corrinoid protein] reductase
     HWN40_00990
SSDB
Motif
Pfam: RACo_C_ter Raco_middle Fer4_6 Fer4_9 Fer4_7 Fer4_10 Fer4_21 Fer4 Fer4_17 Fer4_16 Fer4_4 Fer4_2 Fer4_8
Other DBs
NCBI-ProteinID: QLC48946
UniProt: A0A7D5HZH4
Position
205403..207043
AA seq 546 aa
MYVIALDIGTSGFRSQLIDLEKQETIKTVITMGHPLPGGNVMDHLDFAINTGRDVAHGLM
VEAVKKVLERFDVDPSGIQRIAVCGNPIQLSLFQNTEIRDLAYAGESKQKNLGVYNVKRD
ARIFPANEIFKKTYPMNNCEIVVPPAIKHEIGADALAMMMETDFLEQDGPCLVTDYGTNA
EMALKVGEKIITASAAAGPAIEGQGINCGMLAGPGAISDVNTEGDYWRLIVLNEKMEAVK
GDLVDPVSGKTIESSDTQARGITGTGVISTIALAIKEGLTEKLPHLPEGRIILGDSIIIT
DKDVEEVGKAIGAILAAHMTLMIEAGIDYSDLKYVYMSGASGTYVDAEKARHIGSVPGFV
ENIVQFGNTSIGLARKLAVDPIRLCDVMQIARKIHADHLMMATSETFKDIYICELSYWQQ
GMPQEIYDEMIKMYNIKPFPPKLEKVNIERRVSRDIDDVGKKGLDIVKDIGTILEGPVEK
CILCHKCEKECPEDAVVITEEQGKRFANIDSQHCLGTSCRRCVAICPEQTMDHSKLKIKH
FLKIKR
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgtacgtaattgcactggacattgggacaagtggtttcagatcacagctaatagacctt
gaaaagcaggagacgatcaaaacagtgattaccatgggtcatcctcttcccggtgggaat
gtgatggaccatctggattttgccattaacacaggcagggatgtagcccacggactgatg
gtagaagctgtgaaaaaggtgctggaaagatttgacgttgatccttcgggcatacagaga
atagctgtttgcgggaaccctatacaattatcccttttccagaatacagagattcgggac
cttgcatatgcaggagagtcaaagcagaaaaatcttggtgtatataatgtgaaaagggat
gcccgcatctttcctgccaacgagatattcaaaaaaacctatcctatgaataactgcgag
atagtagttcctcctgcaataaaacacgagatcggggctgatgctcttgccatgatgatg
gaaaccgattttcttgaacaggacggaccatgcctggtaacggattacggaacaaatgcg
gaaatggcactgaaggtcggggaaaagataatcactgcaagtgccgctgccggtccggcc
attgaaggtcagggtatcaactgcggtatgctggcaggtcccggagccataagcgatgtt
aatactgagggtgattactggcgacttatagtactcaatgagaagatggaagcagtaaag
ggagaccttgtagatccggtttccggcaaaaccatagagtcctctgatactcaggccagg
ggtattacaggtacgggagtaatttccaccatcgccctggcaatcaaggaaggactcaca
gagaagttgccccatcttcccgaagggaggatcatcctcggagacagcatcataatcaca
gataaagatgtggaagaagtgggcaaggcaataggtgccatactggcagcccatatgacc
ctgatgatagaagccggtattgattactccgacctgaaatacgtctatatgtccggagcc
agtggtacatatgtagatgctgaaaaagcaaggcatataggttctgttccgggttttgtc
gagaacatcgtccagtttggcaacacttccatcggccttgcgagaaagcttgccgtagat
cctatcaggctatgcgatgttatgcaaatagcaagaaaaatacatgccgatcacctcatg
atggccacaagcgagacattcaaggatatatatatctgcgaactttcctactggcagcag
ggaatgccccaagagatctatgatgagatgatcaaaatgtataatatcaagcccttccct
cccaaactcgaaaaggtgaatatcgaaagacgtgtttcaagggacatcgatgatgtgggt
aaaaaaggccttgatattgtaaaggatataggtactatccttgaaggacccgtggaaaaa
tgtattctgtgccataaatgtgaaaaagaatgtcctgaagacgctgtagttataactgaa
gagcagggcaagaggtttgcgaatatagacagtcagcactgccttggtacgagctgcagg
cgttgtgttgccatctgtcccgagcagacaatggaccattcgaaattgaaaataaagcat
ttcctgaaaataaagcgctga

DBGET integrated database retrieval system