KEGG   Nocardia arthritidis: F5544_27470
Entry
F5544_27470       CDS       T06735                                 

Definition
(GenBank) methyltransferase domain-containing protein
  KO
K18846  16S rRNA (adenine(1408)-N(1))-methyltransferase [EC:2.1.1.180]
Organism
nah  Nocardia arthritidis
Brite
KEGG Orthology (KO) [BR:nah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:nah03009]
    F5544_27470
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:nah01504]
    F5544_27470
Enzymes [BR:nah01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.180  16S rRNA (adenine1408-N1)-methyltransferase
     F5544_27470
Ribosome biogenesis [BR:nah03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    F5544_27470
Antimicrobial resistance genes [BR:nah01504]
 Gene variants
  Aminoglycoside resistance genes
   16S rRNA methyltransferases
    F5544_27470
SSDB
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_4 Ubie_methyltran Methyltransf_11 MTS Methyltransf_12
Other DBs
NCBI-ProteinID: QIS13348
UniProt: A0A6G9YJI6
Position
complement(6155022..6155618)
AA seq 198 aa
MIARYRAVRIDLGTGDGRAVLAAAAADPEVLVIGVDANASAMAEASRRALRGGPSNAIFV
AAGIERLPAALTDIADRVTVNFPWGSLLRGLLTADAHMLASVAAIMKPGAALTILLSVTE
HDRAAGPAVTETGLLSRLVAPYAAAGLAITGIAPVTATDVVAAGSSWGKRLGAGSKRIAW
RVGARRVGEGEEKRYVVS
NT seq 597 nt   +upstreamnt  +downstreamnt
ctgattgcccgttatcgggcggtgcggatcgacctgggtaccggtgacggtcgggcggtg
ctggccgcggcggcggccgatcccgaagtattggtgatcggcgtcgacgcgaatgcttcg
gcgatggccgaggcgtcccggcgggcgctgcgcggtggaccgtccaacgcgatattcgtc
gccgcgggtatcgaacgtctgcccgccgcgttgacggacatcgccgaccgggtgacggtg
aatttcccgtggggttcgctgttgcgcggactgctcaccgcggatgcccacatgctggcg
tccgtggccgctatcatgaaacccggtgcggcactgacgattctgctgtcggtgaccgag
cacgaccgggccgccggaccggccgtgaccgagacgggcctactttcgcggctggtcgcg
ccgtatgccgcggcgggactggcgattaccgggatcgcacccgtcacggccacggatgtt
gtcgcggcggggtcgagttgggggaaaaggctcggagcaggcagtaaacgcatcgcctgg
cgcgtgggggcgaggcgggtcggagaaggggaggaaaaacgttatgtcgtttcgtaa

DBGET integrated database retrieval system