KEGG   Novosphingobium aromaticivorans: Saro_0106
Entry
Saro_0106         CDS       T00322                                 
Name
(GenBank) phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00230  Purine metabolism
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
Module
nar_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Saro_0106
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_0106
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_0106
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     Saro_0106
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     Saro_0106
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_0106
SSDB
Motif
Pfam: AICARFT_IMPCHas MGS
Other DBs
NCBI-ProteinID: ABD24555
UniProt: Q2GC68
Position
109446..111035
AA seq 529 aa
MTEVTIKRALLSVSDKSGLVDLGKALAARGVELLSTGGTAKALRDAGLAVKDVSEHTGFP
EMMDGRVKTLHPTIHGGLLAVRDNPEHAAAMAEHAIGAIDLVVVNLYPFEATVAKGAERE
EVIENIDIGGPSMVRSAAKNHEYVTILTDAADYAAFLGELDQTGGATTLAFRRKMAAKAY
AATAAYDAAISQWFATVDQQEHFPPVLAAAHTRVTTLRYGENPHQDAALYVPRNPAVTGL
PQATQVQGKELSYNNYNDANAALELVAEFAGAKPTVVIVKHANPCGVATAETLLEAWKDA
LECDSVSAFGGIVATNVPLDGPTANAICEIFTEVVVAPGADDAAKEAFARKKNLRLLLID
SLPDAGRKGLVTVPIAGGLLVQDRDAGKIDKSDLKVVTKRAPTERELEDALFAWTVAKHV
KSNAIVYAKDGVTAGIGAGQMNRRDSSRIAAAKAREAAETHHFSEVRTVGSAVASDAFFP
FADGLMAAVEAGATCVIQPGGSIRDEDVIKAADEAGLAMVFTGMRHFRH
NT seq 1590 nt   +upstreamnt  +downstreamnt
gtgaccgaggttaccatcaagcgggcgctgctttcggtgtccgacaagtccggccttgtc
gatctgggcaaggcgctggccgcgcgcggcgtcgaactgctgtccaccggcggtactgcc
aaggcgctgcgcgatgccggcctggcggtgaaggacgtgtccgagcacaccgggtttccc
gaaatgatggacggccgcgtcaagacgctgcacccgacgatccacggaggcctgctggcc
gtacgagacaatcccgaacacgccgctgcgatggccgagcacgcgatcggtgcgatcgat
ctcgtcgtggtcaacctctacccgttcgaagcgaccgtggccaagggtgcggagcgtgag
gaggtgatcgagaacatcgacatcggcggaccttcgatggtccgttcggcggcgaagaac
cacgaatacgtcaccatcctgacggatgcggccgactatgccgcgttccttggcgaactc
gaccagaccggcggcgcgacgacactcgccttccgccgcaagatggccgccaaggcctat
gccgcaaccgccgcctatgatgcggcaatctcgcagtggttcgcgaccgtggaccagcag
gaacacttcccacccgtcctcgccgccgcgcacacccgcgtgaccacgctgcgctatggc
gagaaccctcaccaggatgccgcactctacgttccgcgcaatcccgccgtcaccggcctg
ccgcaggcgacccaggtgcagggcaaggagctgtcctacaacaactacaacgatgccaac
gcagcgcttgaactggtcgccgagttcgcgggcgcgaagccgacggtggtgatcgtgaag
cacgccaacccctgcggcgtggcaacggcggaaacgctgcttgaagcgtggaaggacgcg
ctcgagtgcgactcggtctcggcattcggcgggatcgtggcgacgaacgttccgctcgac
gggccaaccgcaaacgcaatctgcgagatattcaccgaagtggttgtggcgccgggcgca
gatgacgcggcgaaggaagccttcgcacgcaagaagaacctgcgcctgctgctgatcgat
tcgcttcccgatgcgggccgcaagggcctcgtcaccgtgccgatcgcgggcggtctactg
gtgcaggaccgcgatgcgggcaagatcgacaagtccgacctcaaggtggtgaccaagcgc
gcgccgaccgaacgggagctggaggacgcgctcttcgcctggaccgtggcaaagcacgtc
aagtcgaacgccatcgtctatgccaaggacggcgtgacggccggcattggcgcaggccag
atgaaccgccgcgacagctcgcgcatcgccgccgcgaaggccagggaagcggccgaaacc
catcacttcagcgaagtgcgcacggtaggctcggcagtagcctccgacgcgttcttcccc
tttgccgatggcctgatggcggccgtggaagcgggagccacctgcgtgatccagcccggt
ggctcgatccgcgacgaggatgtgatcaaggctgctgatgaagccggccttgccatggtc
ttcaccggaatgcgccacttccgccactga

DBGET integrated database retrieval system