KEGG   Novosphingobium aromaticivorans: Saro_0809
Entry
Saro_0809         CDS       T00322                                 

Name
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00362  Benzoate degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00650  Butanoate metabolism
nar00900  Terpenoid backbone biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
nar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_0809
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_0809
   00650 Butanoate metabolism
    Saro_0809
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_0809
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_0809
   00310 Lysine degradation
    Saro_0809
   00380 Tryptophan metabolism
    Saro_0809
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saro_0809
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_0809
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_0809
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_0809
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Saro_0809
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_0809
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2802
Other DBs
NCBI-ProteinID: ABD25254
UniProt: Q2GA69
Position
861245..862423
AA seq 392 aa
MTDIYIVSGARTAIGSFGGGLASLRPAESGAIVIKEAIARAGIAPDKVQNVVIGTVVPTQ
PKDAYVSRVAAVNAGIPIEAPAMNVNRLCGSGLQAIVSAAQGIALGEQDIAIGGGAESMS
NAPHMVLTARNGQKMGDQVLMDAMLGALHDPFEGIHMGVTAENVAERCQITREEQDSLAV
ESHKRAAAAIAAGYFKEQIVPVEIKTRKGVVVFDTDEHVRADASVEAMAGLKPVFKKDGT
VTAGNASGINDGAAAVVLASGKAVEEHGLKPMARILGWGHAGVEPNVMGLGPVKAVPVAL
QRAGLDLDQIDVIEANEAFAAQACGVAKELGFDPAKTNPNGSGISLGHPIGATGAILTIK
TMYELHRTGGRYGLITMCIGGGQGIAMVIERV
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaccgacatctacatcgtctcgggcgcgcgtaccgccatcggctcgttcggcggcggg
ctcgcttcgctgcgtccggcagagagcggcgccatcgtgatcaaggaagccatcgcccgc
gccgggatcgcgccggacaaggtgcagaacgtggtgatcggcacggtggtgccgacccag
cccaaggacgcctacgtcagccgcgtggccgcggtgaatgccggcattccgatcgaagcc
cccgcgatgaacgtgaaccgcctgtgcggttcgggcctgcaggcgatcgtctcggccgca
cagggcattgcccttggcgagcaggacatcgccatcggcggcggcgcggaaagcatgtcg
aacgcgccgcacatggtgctgaccgcgcgcaacggccagaagatgggcgaccaggtgctg
atggacgccatgctcggcgcgctgcacgatccgttcgaaggtatccacatgggcgtgacc
gcggagaacgtggccgagcgctgccagatcacgcgcgaggagcaggactcgctggcggtt
gagagccacaagcgcgcggcagcggccatcgcggctggctacttcaaggagcagatcgtc
ccggtcgagatcaagacgcgcaagggcgttgtcgtgttcgacaccgacgagcacgtccgc
gccgatgcctcggtcgaggcgatggcggggctgaagccggtgttcaagaaggacggcacg
gtcacggccggcaacgccagcggcatcaacgacggcgcggccgccgtggtgctggcgagc
ggcaaggcggttgaagagcacggcctgaagccgatggccaggatcctcggctggggtcac
gcgggcgtcgagccgaacgtgatgggtctcggcccggtcaaggccgtgccggtggcgctg
cagcgcgcagggcttgacctcgaccagatcgacgtgatcgaggccaacgaggccttcgcc
gcgcaggcttgcggcgtcgccaaggaactgggcttcgaccccgccaagaccaaccccaac
ggctcgggcatttcgctgggtcatcccatcggtgcgaccggcgcgatcctgacgatcaag
acgatgtacgagctgcaccgcaccggcgggcgctatggcctgatcaccatgtgcatcggc
ggtggccagggcatcgccatggtcatcgagagggtctga

KEGG   Novosphingobium aromaticivorans: Saro_0867
Entry
Saro_0867         CDS       T00322                                 

Name
(GenBank) Acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00362  Benzoate degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00650  Butanoate metabolism
nar00900  Terpenoid backbone biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
nar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_0867
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_0867
   00650 Butanoate metabolism
    Saro_0867
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_0867
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_0867
   00310 Lysine degradation
    Saro_0867
   00380 Tryptophan metabolism
    Saro_0867
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saro_0867
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_0867
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_0867
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_0867
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Saro_0867
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_0867
SSDB
Motif
Pfam: Thiolase_N Thiolase_C DUF5708
Other DBs
NCBI-ProteinID: ABD25312
UniProt: Q2GA11
Position
complement(920716..921891)
AA seq 391 aa
MRDAVIVSAARTPIGRAYKGAFNATPGATLGALSLEAAVARAGIDPAEVDDVLWGAALQQ
GAQAGNIARQVALRAGLPITTSGMSMDRQCSSGLMTIATASKQVIIDRMDVVAAGGQESI
SLVQTKDMRVAPDKSLMAMHKAIYMPMLQTAEIVGQRYGISREACDEYALQSQQRTAAAQ
AAGKFDDEIVAVDTTMGVQNKETGEVTFQDVHLTKDEGNRPSTTIENLQALKPVIEGGIV
TAGNASQLSDGSAAVVVMEAALAAKKGLAPLGRYVGMAVAGTEPDEMGIGPVFAIPKLLQ
RFGLKMDDIGLWELNEAFAVQVLYCRDKLGIPNDLLNVNGGSISIGHPYGMTGARCTGHA
LIEGKRRGAKYVVVTMCVGGGMGAAGLFEVL
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgcgtgacgccgtaatcgtatccgccgctcgcacgcctatcgggcgcgcctacaagggc
gccttcaatgccactcccggcgcgacgctgggcgcgctttcgctggaagccgccgtggcg
cgggcggggatcgaccctgccgaggtcgacgacgtgctgtggggcgcggcgctccagcag
ggcgcccaggccggcaacatcgcgcgccaggtggcgctgcgcgcaggcctgccgatcacc
acttcgggcatgagcatggatcgccagtgctcgtcgggtctgatgaccatcgccaccgct
tcgaagcaggtgatcatcgaccgcatggacgtggttgccgccggcggccaggaatcgatc
agcctcgtccagaccaaggacatgcgcgtcgccccggacaagagcctgatggcgatgcac
aaggcgatctacatgccgatgctgcagaccgcagagatcgtcggccagcgctatggcatc
agccgcgaggcctgcgacgaatatgccctgcaatcgcagcagcgcaccgccgccgcgcag
gccgcgggcaagttcgatgacgagatcgtcgccgtggacacgacgatgggcgtccagaac
aaggaaaccggcgaagtcaccttccaggacgttcacctgaccaaggacgaaggtaatcgt
ccctcgaccacgatcgagaacctccaggcgctgaagccggtgatcgagggcggcatcgtg
acggcgggcaacgccagccagctatcggacggttccgcggcggtcgtcgtgatggaagcg
gcgctggcggcaaagaagggcctggccccgctcggacgctatgtcggcatggccgttgcc
gggaccgagcccgacgagatgggcatcggcccggtcttcgcgatccccaagctgctccag
cgcttcgggctgaagatggacgacatcggcctgtgggagctgaacgaagccttcgcggtg
caggtgctttactgccgcgacaagctgggcatccccaatgacctgctcaacgtcaacggc
ggctcgatctcgatcggccacccttatggcatgaccggcgcgcgctgcaccggccacgcg
ctgatcgaaggcaagcgtcgcggcgcgaagtacgtggtggtcaccatgtgcgtcggcggc
ggcatgggcgcggcgggacttttcgaagtcctctga

KEGG   Novosphingobium aromaticivorans: Saro_1069
Entry
Saro_1069         CDS       T00322                                 

Name
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00362  Benzoate degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00650  Butanoate metabolism
nar00900  Terpenoid backbone biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
nar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_1069
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_1069
   00650 Butanoate metabolism
    Saro_1069
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_1069
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_1069
   00310 Lysine degradation
    Saro_1069
   00380 Tryptophan metabolism
    Saro_1069
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saro_1069
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_1069
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_1069
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_1069
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Saro_1069
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_1069
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-ProteinID: ABD25514
UniProt: Q2G9F9
Position
1113487..1114659
AA seq 390 aa
MATAYIVDAVRTAGGRRGGRLAGVHPVDLAARSLDAIVARTGIDPTAVDDVIMGCVTQAG
QQAMQVGRNAVLASKLLPQSTPAVTIDRQCGSSQQAIQFAAQAVMSGVQDMVIAAGVESM
SRVPMGSNATFHMKEGLGHYKSPGLEEKYPGVMFSQFMGAEMIVKKHGFTKDDLDRFSLD
SHRKAIAATNAQAFANEIVPVEIETPEGPAMHTVDEGIRFDATLEGIAGVKLLSPEGSLT
AASSSQICDGSSAVLVVSEAALKAHGLTPLARIHNLTVTAGDPVIMLEEPLFATDRALQR
AGMKISDIDLYEVNEAFASVPMAWLKHTGADPEKLNVNGGAIALGHPLGASGSKLMATLV
HALRARGGKYGLQTMCEGGGVANVTIIEAL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggctacagcctatatcgtcgatgcggttcgcacggcaggcggtcggcgcgggggcagg
cttgcgggcgtccatccggtggacctcgccgctcgcagcctcgatgcgatcgtcgcgcgc
accggcatcgacccgaccgcggtcgacgacgtcatcatgggctgcgtcacccaggccggt
cagcaggcaatgcaggtgggccgcaacgcggtgctcgcctcgaagctgctgccgcagtcg
acgccggccgtcaccatcgaccgccagtgcggttcttcgcagcaggcgatccagttcgcg
gcgcaggctgtcatgtctggcgtgcaggatatggtcatcgcggcgggcgtcgagagcatg
agccgcgtgccgatgggctccaacgccacgttccacatgaaggaggggctcggtcactac
aagtcgccggggctggaagaaaagtatcccggggtcatgttctcccagttcatgggcgcg
gaaatgatcgtgaagaagcatggcttcaccaaggacgatctcgaccgcttctcgctggac
agccatcgcaaggcgattgcggcaaccaatgcccaggccttcgcgaacgaaatcgtgccg
gtagagatcgagacgcccgaaggccccgcaatgcacaccgtggacgaaggtatccgcttc
gacgctacgctcgagggcatcgccggcgtcaagctgctcagccccgaaggctcgctcacc
gctgccagctccagccagatctgcgatggttcgagtgccgtgctggtcgtgtcggaagct
gcgctcaaggcgcatggacttaccccgctggcgcgcatccacaatctgacagtgaccgcg
ggcgatccggtgatcatgctcgaagagccgctcttcgccaccgatcgtgcattgcagcgc
gcgggcatgaagatttccgacatcgacctatacgaagtgaacgaggcgttcgcctccgtt
ccgatggcttggctgaagcacaccggcgccgatccggaaaagctcaacgtcaacggcggc
gcgatcgcgcttggccatccgctgggcgcttcgggcagcaagctcatggcgacgctcgtc
cacgccctgcgcgcgcggggcggaaagtacggtttgcagacgatgtgcgaaggcggcggc
gtggccaacgtcacgatcatcgaggcactttga

KEGG   Novosphingobium aromaticivorans: Saro_1222
Entry
Saro_1222         CDS       T00322                                 

Name
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00362  Benzoate degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00650  Butanoate metabolism
nar00900  Terpenoid backbone biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
nar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_1222
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_1222
   00650 Butanoate metabolism
    Saro_1222
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_1222
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_1222
   00310 Lysine degradation
    Saro_1222
   00380 Tryptophan metabolism
    Saro_1222
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saro_1222
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_1222
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_1222
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_1222
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Saro_1222
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_1222
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: ABD25667
UniProt: Q2G906
Position
complement(1274354..1275568)
AA seq 404 aa
MTQLRHAAIVAPIRTAVGKFGGSLSPLTAGQLGATILTALMDRTRIDPARVDDVIFAQGY
GNGEAPCISHWSWLLAGLPEEVPGYQLDRRCGSGLQSIVNAAMMVQTGVSDVVVAGGVES
MSNVEHYTTDVRKGVRAGSLTLHDRLTRGRVMSQPIERYGVISGMIETAENLAKDFAITR
EACDAYAVRSHQRAAAAWANGLFDDELVPVSIPQKKGDPVLFAHDEGYRADASMETLGKL
RPLEGGVVTAGNASQQNDAAAACLVVAEDKLAELGLEPIAWFHSWAAAGCDPSRMGYGPV
PATERLFARNGLTWNDIDLIELNEAFAPQVLACLKGWGWSDDDSRHEMLNVNGSGISLGH
PIGATGGRILANLTRELKRRGGRYGLETMCIGGGQGIAAVFEAA
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgacccagcttcgccacgccgccatcgtcgcccccatccgcaccgccgtgggcaagttc
ggcggctcgctgtcgcctctcaccgccgggcaactgggcgcaacgatcctcacggcgctg
atggaccgcacaaggatcgaccccgcgcgcgtcgatgacgtgatcttcgcgcagggttac
ggcaacggcgaggcgccgtgcatctcgcactggtcgtggctgctcgcgggcctgcccgag
gaagttcccggctaccagctcgatcgccgctgcggctcgggcctccagtcgatcgtcaat
gcggcgatgatggtgcagaccggggtttccgacgtcgtcgtggcgggcggcgtggaatcg
atgtccaacgtcgagcactataccactgacgtccgcaagggcgtgcgcgcgggctcgctg
acccttcacgaccgccttacccgtggccgcgtgatgagccagccgatcgagcgctatggc
gtgatcagcggcatgatcgagacggcggaaaacctcgccaaggactttgccatcacccgc
gaagcctgcgacgcctatgccgtgcgcagccaccagcgcgcggctgctgcatgggccaac
ggcctgttcgacgacgaactcgttccggtctccatcccccagaaaaagggcgaccccgtt
ctcttcgcccacgacgagggttaccgtgccgacgccagcatggaaacgcttggcaagctg
cgccccctcgaaggcggcgtcgtgacggcaggcaacgccagccagcagaacgacgcggcc
gccgcctgcctcgtcgtcgcggaagacaagctcgccgaactcggcctcgaacccatcgcg
tggttccattcctgggcggcagcgggctgcgatccgagccgcatgggctatggccctgtc
cccgctaccgagcgcctgttcgcccgcaacggcctgacgtggaacgacatcgacctcatc
gaactgaacgaggccttcgcccctcaggttctcgcctgcctcaagggctggggctggtcg
gacgacgacagccgccacgagatgctgaacgtcaatggctcgggcatcagcctcggccat
cccatcggcgccaccggcgggcgcatcctcgccaaccttacgcgcgaattgaagcggcgc
ggcgggcgctatggccttgaaaccatgtgcattggtggcggtcagggaatcgcggcggtg
ttcgaggcggcctga

KEGG   Novosphingobium aromaticivorans: Saro_2306
Entry
Saro_2306         CDS       T00322                                 

Name
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00362  Benzoate degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00650  Butanoate metabolism
nar00900  Terpenoid backbone biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
nar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_2306
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_2306
   00650 Butanoate metabolism
    Saro_2306
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_2306
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_2306
   00310 Lysine degradation
    Saro_2306
   00380 Tryptophan metabolism
    Saro_2306
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saro_2306
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_2306
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_2306
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_2306
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Saro_2306
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_2306
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt PepSY_2
Other DBs
NCBI-ProteinID: ABD26743
UniProt: Q2G5Y0
Position
2446328..2447524
AA seq 398 aa
MAQFSSSDPVVILSYARTPMGAMQGALAEVAATDLGATAVKAAVERAGVAPDKVERIYMG
CVLPAGLGQAPARQAAIKAGLPKSVQATTVNKVCGSGMQTIIMGAEALAAGSADLIVAGG
MESMTNAPYLLKKHRSGARIGHDMAYDHMFLDGLEDAYDAGRAMGTFAQDTANAYQLTRE
QQDAYSIESLRRAQAAVADGSFKDEVVAVTVKTRAGEVTVDTDEAPGKGRPDKIPSLKPA
FAKDGTITAATSSSISDGAAAVVLARQSVAAAAGLAPVARIVALAAHAQEPKDFTTAPVG
AIQKVLDKAGWSIADVDLFEVNEAFACVAMFAMHDLGIPHEKINVHGGATALGHPIGASG
TRIVTTLIAALRKHGKTKGVASLCIGGGEATALAIELV
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcacagttctcctcgtccgatcccgtcgtcattctgtcctacgcacgcacgccgatg
ggcgcgatgcagggtgccctggcagaggtcgccgccaccgacctcggcgccaccgcggtc
aaggccgccgttgagcgcgcgggcgtcgcgcccgacaaggtcgagcgcatctacatgggc
tgcgtgcttcccgccggcctcggccaggcacccgcacgtcaggccgcgatcaaggccggc
ctgcccaagtcggttcaagcgacaaccgtcaacaaggtctgcggttcgggcatgcagacg
atcatcatgggcgccgaggctctggccgcgggcagcgccgacctgatcgtcgcgggcggc
atggaatcgatgaccaacgccccctacctgctcaagaagcatcgctcgggcgcgcgcatc
ggtcacgacatggcctatgaccacatgttcctcgacgggctcgaggatgcctacgacgcc
ggccgcgccatgggcacgttcgcgcaggacaccgccaacgcctatcaactcacccgcgaa
cagcaggacgcctactcgatcgaatcgctccgccgcgcgcaggccgccgtcgccgacggc
tcgttcaaggacgaagtcgtcgcggtcaccgtcaagacccgcgccggtgaagtgacggtc
gatacggacgaggcacccggcaagggccgtcccgacaagatcccctcgctcaagccagcc
ttcgccaaggacggcacgatcaccgccgccacctcgtcgtcgatttccgacggcgcggcc
gccgtggtcctcgcccgccaaagcgttgccgccgccgccggtcttgcgccggtcgcgcgg
atcgtcgcccttgccgcccacgcgcaggaaccgaaggacttcaccaccgctccggtcggc
gcgatccagaaggttctcgacaaggccggctggtccattgccgacgtcgacctgttcgag
gtgaacgaggcgttcgcctgcgtcgcgatgttcgcgatgcacgacctcggcatcccgcac
gagaagatcaacgtccatggcggcgccaccgcgctcggtcacccgatcggcgcttcgggc
acccgcatcgtcaccacgctgatcgccgcgctcaggaagcatggcaagacgaagggcgtc
gccagcctctgcatcggcggcggcgaggcgacggccctcgcgatcgagctggtctga

KEGG   Novosphingobium aromaticivorans: Saro_2349
Entry
Saro_2349         CDS       T00322                                 

Name
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00362  Benzoate degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00650  Butanoate metabolism
nar00900  Terpenoid backbone biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
nar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_2349
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_2349
   00650 Butanoate metabolism
    Saro_2349
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_2349
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_2349
   00310 Lysine degradation
    Saro_2349
   00380 Tryptophan metabolism
    Saro_2349
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saro_2349
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_2349
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_2349
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_2349
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Saro_2349
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_2349
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-ProteinID: ABD26786
UniProt: Q2G5T7
Position
2495287..2496534
AA seq 415 aa
MPEAYIIDAVRTPRGIGKPGKGALSHLHPQHLAATVLKALKDRNDLDTSTVDDIIWSTSS
QVGKQGGDLGRMAALAAGYDISASGTTLDRFCGGGITSVNLACASVMSGMEDCVIAGGTE
MMSFTAAHGAELANAGIKPLGMGSGNMELDALHPQSHQGVCGDAIAAREGIDRMALDALA
LVSQERADRAIREGRFDKSVVTVYNPDGTVALDHEEFPRPETTMEGLSSLKASFDGIADF
DLGGTTFRKQIQRRYPELEWKGVHHAGNSSGVVDGAAALLIVSPAYAEKHGLKPRARIVA
YANQGDDPTLMLNAPVPAARKVLDKAGLSKDDIDVWEINEAFAVVAEKFIRDLELDRDKV
NINGGAMALGHPIGATGSILIGTALDELERSGGRYGLVTMCAAGGMAPAIIIERI
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcccgaagcctatatcatcgacgccgtccgtacgccgcgcgggatcggcaagcccggc
aagggcgccctttcgcacctgcacccgcagcatcttgccgcgacggtgctcaaggcgctg
aaggaccgcaacgacctggacacctcgaccgtcgacgacatcatctggtcgacctcgtcg
caggtgggcaagcagggcggcgatcttggccgcatggcagcgctggcggcagggtacgac
atctcggccagcggcacgacgctcgaccggttctgcggcggcggcatcacttcggtgaac
cttgcctgcgcctcggtcatgtcgggcatggaagattgcgtgatcgccggcggcaccgag
atgatgagcttcaccgccgcccacggcgcggagctggccaatgccgggatcaagccgctg
ggcatgggttcgggcaacatggaactggatgccctgcacccgcagtcgcaccagggcgtg
tgcggcgatgccattgccgcgcgcgaggggatcgaccgcatggcgctcgacgcgctcgcc
ctcgtaagccaggaacgcgccgaccgcgcgatccgcgaggggcgcttcgacaagtcggtg
gtcaccgtctacaaccccgacggcacggtggcgctcgaccacgaggaattcccgcgtccg
gaaacgacgatggaaggcctgtcctcgctcaaggcaagcttcgacggaattgccgacttc
gaccttggcggcaccacgttccgcaagcagatccagcgccgctatccggaactggagtgg
aagggcgtgcatcacgcgggcaactcctccggcgtggtcgacggtgcggcggcgctgctg
atcgtttcacccgcctatgccgagaagcatggcctgaagccgcgcgcgcgcatcgttgcc
tatgccaaccagggcgatgacccgacgctcatgctgaacgctccggtgccggcggcaagg
aaggtcctcgacaaggctggcctttcgaaggacgacatcgacgtctgggaaatcaacgag
gccttcgcggtcgtggccgagaagttcatccgcgatctcgaactggaccgcgacaaggtg
aacatcaacggcggcgcgatggcattgggccatccgatcggcgcgacgggatcgatcctg
atcggcaccgcgctcgacgaactggagcggtcgggcgggcgctatggcctggtcacgatg
tgcgcggcaggcggcatggcaccggcgatcatcatcgaacgcatctga

KEGG   Novosphingobium aromaticivorans: Saro_2502
Entry
Saro_2502         CDS       T00322                                 

Name
(GenBank) conserved hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00362  Benzoate degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00650  Butanoate metabolism
nar00900  Terpenoid backbone biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
nar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_2502
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_2502
   00650 Butanoate metabolism
    Saro_2502
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_2502
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_2502
   00310 Lysine degradation
    Saro_2502
   00380 Tryptophan metabolism
    Saro_2502
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saro_2502
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_2502
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_2502
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_2502
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Saro_2502
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_2502
SSDB
Motif
Pfam: TLP1_add_C
Other DBs
NCBI-ProteinID: ABD26938
UniProt: Q2G5D5
Position
complement(2703561..2705093)
AA seq 510 aa
MQVSETTPIIVGVGQFVERIDAPDYAGLSFADLSARAGAAALADARAALPLAPMVKAVGA
IRTFEESGAMQVPFGRADKMPLAVARRLGIEPEVAILEKVGGQSPLALLADMGARIASGE
VTAALMFGSEAISTVRHLTTRGESRDWAEHDDGEMIDKGMGFEGTLSPVSIAHGIRAPVV
AYALCENARRARLGLSREAYAAEMGRLFSPFTEVAARNPYSAAAVKPMSAGEIATPGERN
RMIADPYPLKLVSRDQVNQAAAVLLMSVKAAREAGVPEERWVFLHGAALANEREILDRPD
IGAYPAARAAIASAFARAGRSVADIAAFDFYSCFPIPVFNAAIDGLGLSPDDPRGLTVTG
GLPYFGGAGNNYSMHAFASMAERLRAKPGDFGFVGLNGGFQSKYGAAIFSTEPCEWPGCE
TGSIQQKLDAAAKPSMAPAPEGRGRIGTYTVTYAKGVPEQAIVIGEMLSGGRFIAASREP
ETVTAMTEVDPLGREVSVTPSEKRNSFTFA
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgcaggtatctgaaacgacgccgattatcgtcggcgtcggccagttcgtcgagcggatc
gacgcccccgactatgcgggcctttcgtttgccgatctatcggcgcgcgcgggggccgcg
gcgcttgccgatgcgcgtgcggcgctgccgctggcgccgatggtgaaggcggtcggggcg
atcaggacgttcgaggaatcgggcgcgatgcaggtgcctttcgggcgcgcggacaagatg
ccgctggcagtcgcgcgccggctcggcatcgagccagaggtggcgatcctggagaaggtc
ggcgggcaatcgccgctggctctgcttgcggatatgggcgctcgcatcgcatcgggcgag
gttacggcggcgctcatgttcggcagcgaggcgatctctaccgtgcgtcacctgacgacc
cggggcgagagccgcgactgggccgaacatgacgatggcgagatgatcgacaaaggcatg
gggttcgagggtacgctttcgccagtgagcatcgcccacggcatccgggcgccagtcgtt
gcctatgcgctgtgcgagaatgcccgccgggcaaggctgggcctgtcgcgcgaggcctat
gcagccgagatgggacggcttttctcgccattcaccgaggtggccgcgcgcaatccctac
agcgcggctgcggtaaagcccatgagcgccggggaaatcgccacccccggcgagcgcaat
cgcatgattgccgatccctatccgctcaagctcgtgtcgcgcgaccaggtcaaccaggcg
gcggccgttctgctgatgtcggtgaaggccgcccgggaggcgggggtgcccgaggaaagg
tgggtgttcctccacggcgccgcgcttgccaacgaacgcgagatcctcgaccgtccggac
atcggtgcctatccggcagcccgcgccgccatcgcctccgcctttgcccgtgccggcagg
agcgtggccgacatcgcggcgttcgatttctattcctgctttccgatcccggtattcaac
gcggccatcgacggacttggcctttccccggacgatccgcgcgggcttacggtcacgggc
gggcttccttacttcggcggggcgggcaacaactattcgatgcacgctttcgccagcatg
gccgaacgcctgcgcgcgaagccgggcgactttggcttcgtcggcctcaatggcgggttc
cagtcgaaatacggcgccgcgatcttctcgaccgagccgtgcgaatggccggggtgcgag
acgggatcgatccagcagaagctcgatgcggcggccaagccctccatggcacctgcaccg
gaagggcgcgggcggatcgggacatataccgtcacttacgccaagggcgtgccggagcag
gcgatcgtgatcggcgagatgctgtccggcggacgcttcattgcagcgagccgcgagccg
gaaacggtcaccgccatgacggaggtcgatcctctcggacgcgaggtttccgtcacgcca
tccgaaaagcgcaacagcttcactttcgcctga

KEGG   Novosphingobium aromaticivorans: Saro_3758
Entry
Saro_3758         CDS       T00322                                 

Name
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00362  Benzoate degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00650  Butanoate metabolism
nar00900  Terpenoid backbone biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
nar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_3758
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_3758
   00650 Butanoate metabolism
    Saro_3758
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_3758
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_3758
   00310 Lysine degradation
    Saro_3758
   00380 Tryptophan metabolism
    Saro_3758
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saro_3758
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_3758
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_3758
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_3758
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Saro_3758
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_3758
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Other DBs
NCBI-ProteinID: ABP64617
UniProt: A4XFA6
Position
pNL2:396663..397832
AA seq 389 aa
MPARPNMPEAYIIDAVRTPVGRKKGGLAHLHPADLAAHPIRELMARHDFDPALVEDVVWG
CTETIGGQAGDIGRTAWLVAGLAEDVPGVTVDRQCGSAQQAVHFAAQGVMSGTQDIVVAG
GSQAMNRIPIMAAMTAGAAYGFESPFIGAKGWDARYGDQEVNQIRSAEMIAEKWNLSREE
MDAFAYESHRRAQYATEQGWFRNEIVPLEGLDRDETIRPGTTLEGLASLSAVREGGRVTA
GNASQNSDCAAALLIVSERAVKEHNLKPRARIHHMSVRADNPVWMLTGPIPATRYAMQKS
GMKLSDIDLFECNEAFASVPMAWMKELDIPHEKVNVSGGAIALGHPIGSTGAKLMTTLLN
ALERTGGRYGLQTMCEGGGQANVTIIERL
NT seq 1170 nt   +upstreamnt  +downstreamnt
ttgcccgcgagaccgaacatgcctgaagcctacattatcgacgccgtgcgcacgcccgtc
gggcgcaaaaagggcggcctcgcccatctccatccggcagaccttgctgcacacccgatc
cgcgaactgatggcgcggcacgacttcgatcctgcgttggtcgaggatgtggtgtgggga
tgcaccgaaacgatcggcgggcaagcgggcgatatcgggcgcacggcatggctcgtcgca
ggacttgccgaggacgtgccgggcgtgaccgtcgatcgccagtgcgggtcggcacagcag
gcggtgcattttgccgcacagggcgtgatgagcgggacgcaggatattgtcgttgccggt
ggcagccaggcgatgaaccgaattccgatcatggccgcgatgacagccggtgccgcatat
ggattcgaaagcccgttcatcggcgccaagggctgggacgcgcgttatggcgaccaggag
gtcaaccagatccgctcggccgagatgatcgccgaaaagtggaacctcagccgcgaggaa
atggacgctttcgcctacgagagccaccgccgcgcgcagtacgcgaccgagcagggctgg
ttcagaaacgagatcgtgccgctcgaaggactagatcgtgacgagacgatccgtcccggc
acgacactggaagggctggcttcgttgagcgccgtgcgtgaaggcgggcgagtcacggcg
ggcaacgcaagccagaattcggactgtgcggcggccctgctgatcgtcagcgagcgtgcg
gtgaaggaacacaacctgaagccacgcgcgcgcatccatcacatgtcggtgcgtgccgac
aatccggtgtggatgctgaccgggccgatcccggcaacgcgctatgccatgcagaaatcg
ggcatgaagctgtcggacatcgacctgttcgaatgcaacgaagcgttcgcttccgtaccg
atggcgtggatgaaggagctcgatatcccgcacgagaaggtcaacgtgtccggcggcgcg
attgcgctgggccatccgatcggatcgaccggtgccaagctgatgacgactttgctgaac
gcccttgaacgcaccggtggccgctatggcctccagacgatgtgcgagggtggcggccag
gcgaacgtcacgatcatcgagaggctttga

KEGG   Novosphingobium aromaticivorans: Saro_3766
Entry
Saro_3766         CDS       T00322                                 

Name
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00362  Benzoate degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00650  Butanoate metabolism
nar00900  Terpenoid backbone biosynthesis
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
nar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_3766
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_3766
   00650 Butanoate metabolism
    Saro_3766
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_3766
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_3766
   00310 Lysine degradation
    Saro_3766
   00380 Tryptophan metabolism
    Saro_3766
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Saro_3766
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Saro_3766
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Saro_3766
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_3766
Enzymes [BR:nar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Saro_3766
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saro_3766
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: ABP64625
UniProt: A4XFB4
Position
pNL2:403133..404335
AA seq 400 aa
MREAAIVSTARTGVGKAYRGAFNDTEAPVLSSHVVNAAIERAGIDPARVDDVYLGVGNHW
NTQSYNLGRLTVHGSVLPDTTAGFTLDRKCSSGLNAIALAARGIMCNEIDVAVAGGMESI
SLTINKHAPAFRNRSEFIKAADPHAYMVMIETAEIVAERYGVSREDQDRFAALSQQRAAA
AQEAGRFDDEIVPITVTKALFDKEGNETGKEQVTLDRDEGVRAGTTYEALAGLKPVFKGG
QVIAEGRHVTAGNASQLSDGASAQVLMDLDTARAEGRPVLGIYRGFQVAGCGAEEMGIGP
VFAIPKLLDRAGLKVEDIGLFEINEAFASQAVYCQQKLDIDPERLNVNGGGIAIGHPFGM
TGSRLVGHALIEGRRRGVKYAVVSMCVAGGMGAAGLFEVA
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgcgtgaagccgccatcgtttcgaccgcccgcactggcgtgggcaaggcctaccgcggt
gccttcaatgacaccgaggcccctgtcctttcctcgcacgtggtcaatgccgcgatcgag
cgtgcgggcattgacccggcgcgggtcgacgacgtttacctcggcgtcggcaaccactgg
aacacgcagagctacaacctcggtcggttgaccgtgcacggttcggtcctgcccgacacg
accgccggcttcactctggaccgcaagtgctcatccgggctcaacgccatcgcgctggcc
gcgcgggggatcatgtgcaacgagatcgacgttgcggtggccgggggcatggaaagcatc
tcgctgaccatcaacaagcacgcgcccgccttccgcaaccggtccgaattcatcaaggcg
gcggacccgcacgcctacatggtgatgatcgagaccgccgagatcgtggccgagcgctat
ggcgtgagccgcgaggatcaggaccgattcgctgcactgtcgcagcagcgcgcggcggcc
gcgcaggaggcgggccggttcgacgacgaaatcgtgcctatcacggtgacgaaggcgctg
ttcgacaaggaaggcaacgagaccggcaaggaacaggtcacactggaccgcgacgagggc
gtgcgcgcgggcacgacctatgaggctcttgctggcctgaagccggtgttcaagggtggt
caggtcattgcagagggccgccatgtcactgccgggaacgcctcgcagctttccgatggc
gcttcggcgcaggtactgatggatctcgacactgcgcgtgccgaaggacgtccagtgctg
ggcatctatcgcgggttccaggtcgctggttgcggcgccgaggaaatgggcattggcccg
gtcttcgccatccccaagctgctcgaccgcgcggggcttaaggtcgaggacatcggtctg
ttcgaaatcaacgaggctttcgcttcgcaggcggtctattgccagcagaagctggatatc
gaccccgaaaggctcaacgtgaatggcggcggaatcgccattggccatccgttcgggatg
accggttcgcgccttgtcggccatgcgctgatcgagggcaggcgccgcggcgtgaagtac
gccgtcgtgtcgatgtgcgtggcgggtggcatgggcgccgccggcctgttcgaagtggcc
tga

DBGET integrated database retrieval system