KEGG   Novosphingobium aromaticivorans: Saro_0898
Entry
Saro_0898         CDS       T00322                                 

Name
(GenBank) formyltetrahydrofolate-dependent phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00230  Purine metabolism
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
Module
nar_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Saro_0898
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_0898
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase 1
     Saro_0898
SSDB
Motif
Pfam: Formyl_trans_N
Other DBs
NCBI-ProteinID: ABD25343
UniProt: Q2G9Y0
Position
complement(954970..955557)
AA seq 195 aa
MAERTPVAVFISGSGTNMAALLYASRMAGCPYEIALVLSNNPDASGLRLAQAESVPTFCL
PHKGIPRAEHDALMEAEVLKSGAQLIALAGYMRILSAEFVARWEGRMLNIHPSLLPKYKG
LHTHDRAIEAGDTHGGCTVHLVTAELDDGPILGQLPVAILPGDTGETLAARVLFAEHQLY
SRVLSTFAIQHQTSV
NT seq 588 nt   +upstreamnt  +downstreamnt
ttggctgaacgcacgcccgtcgcggtcttcatctccggcagcggcaccaacatggccgcg
ctgctctatgcctcgcgcatggcgggctgcccctacgagatcgcgctcgtcctctcgaac
aatcccgatgcttccgggctcaggttggcccaggccgaaagcgttcccaccttctgcctg
ccccacaagggcattccccgcgccgagcatgacgccctgatggaagccgaagtgctcaag
tcgggcgcgcagctcatcgcgctcgccggctacatgcgcatcctcagcgcggaattcgtc
gcgcgctgggaagggcgaatgctcaacatccacccttcgctcctgccgaagtacaagggc
ctgcacacccacgaccgcgcgatcgaggccggcgacacccacggcggctgcacggtccac
ctggtgacggcggaactcgacgacggcccgatcctcggccagcttcccgtcgccattctc
cccggcgacaccggcgaaacccttgccgcccgcgtgctctttgccgaacaccagctctat
tcgcgggtgctctcgaccttcgccatccagcaccagacgagcgtctga

DBGET integrated database retrieval system