KEGG   Novosphingobium aromaticivorans: Saro_1104
Entry
Saro_1104         CDS       T00322                                 

Name
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00053  Ascorbate and aldarate metabolism
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00330  Arginine and proline metabolism
nar00340  Histidine metabolism
nar00380  Tryptophan metabolism
nar00410  beta-Alanine metabolism
nar00561  Glycerolipid metabolism
nar00620  Pyruvate metabolism
nar00625  Chloroalkane and chloroalkene degradation
nar00770  Pantothenate and CoA biosynthesis
nar00903  Limonene and pinene degradation
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_1104
   00053 Ascorbate and aldarate metabolism
    Saro_1104
   00620 Pyruvate metabolism
    Saro_1104
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_1104
   00561 Glycerolipid metabolism
    Saro_1104
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_1104
   00310 Lysine degradation
    Saro_1104
   00330 Arginine and proline metabolism
    Saro_1104
   00340 Histidine metabolism
    Saro_1104
   00380 Tryptophan metabolism
    Saro_1104
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Saro_1104
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Saro_1104
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Saro_1104
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Saro_1104
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Saro_1104
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: ABD25549
UniProt: Q2G9C4
Position
complement(1150672..1152096)
AA seq 474 aa
MRERLQQYIDGKWVDSEGGKRHEVINPTTEEPCCVITLGTQADVDKAVAAAQRAFKTFSK
TTREERLALLERIVEEYKKRVPDLAAAMAEEMGAPVSFASTAQVGAGIGAFLGTMAALRN
FSFVEDNGAFKVAYEPIGVVGMITPWNWPLNQIALKVAPALAAGNTMILKPSEECPTNAA
IFTEILDAAGVPPGVFNLIQGDGPGVGTAISSHPGIDMVSFTGSTRAGILVAKAAADTVK
RVHQELGGKSPNVVLPDADFAKYLPSTASGPLVNSGQSCISPTRILVPREREAEAAAFVS
AMYSATPVGDPMQEGAHIGPVVNKAQFDKIRGLIQSAIDEGAKLETGGPDLPANVNRGYY
IKPTVFSGVTPDMRIAQEEIFGPVATIMAYDSLEEAIEIANDTAYGLSACITGDPAKAAE
VAPELRAGMVAINNWGPTPGAPFGGYKQSGNGREGGLYGLKDFMEMKAISGLPA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgcgcgaacggctacagcaatacattgatggcaagtgggtagacagcgagggtggcaag
cgccacgaggtcatcaatccgacgaccgaggaaccctgctgcgtcatcacgctgggcacg
caggccgatgtcgacaaggcagtggccgcggcccagcgcgccttcaagaccttcagcaag
acgacgcgcgaggagcgactcgcgctgcttgaacgcatcgtcgaggaatacaagaagcgc
gtccccgatctcgccgccgcgatggccgaggaaatgggcgctccggtaagcttcgccagc
accgcgcaggtcggcgccggcatcggcgccttcctcggcaccatggccgcgctccgcaac
ttctccttcgtcgaggacaacggtgcgttcaaggtcgcctacgaaccgatcggcgtcgtc
ggcatgatcacgccatggaactggcccctcaaccagatcgcgctcaaggtcgcaccggcg
ctggccgcgggcaacaccatgatcctcaagccgtccgaggaatgccccaccaacgccgcg
atctttaccgagatcctcgatgccgccggcgtcccgccaggcgtcttcaacctcatccag
ggcgatggtcccggcgtcggcactgcgatcagctcgcacccgggcatcgacatggtcagc
ttcaccggctcgacccgcgcgggcatcctcgtggcgaaggctgcggccgataccgtcaag
cgcgtccatcaggagcttggcggcaagtcgcccaacgtcgtcctgcccgatgcagacttc
gccaagtacctgccgtcgaccgcgtccggcccgttggtcaacagcggccagagctgcatt
tcgcccacccgcattctcgtaccccgcgaacgcgaagccgaagccgcggcgttcgtttcg
gcgatgtactcggcaaccccggtcggcgatccgatgcaggaaggtgcgcacatcggcccg
gtggtcaacaaggcgcagttcgacaagatccgcggcctgatccagtcggcgatcgacgaa
ggcgcgaagctcgagaccggcggccccgacctcccggccaacgtcaaccgcggctactac
atcaagcccacggtcttctccggcgtcacgcccgacatgcgcattgcgcaggaggaaatc
ttcggcccggtcgcgacgatcatggcgtacgacagcctcgaggaggccatcgagatcgcc
aacgacaccgcctatggcctgtcggcctgcatcaccggcgatccggcgaaggcggctgaa
gtcgcgcccgagcttcgcgccggcatggtcgcgatcaacaactggggccccaccccgggc
gcgccgttcggcggctacaagcagtccggcaacggccgcgagggcgggctctatggcctc
aaggacttcatggaaatgaaggcgatcagcggcctgcctgcctga

KEGG   Novosphingobium aromaticivorans: Saro_1197
Entry
Saro_1197         CDS       T00322                                 

Name
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00053  Ascorbate and aldarate metabolism
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00330  Arginine and proline metabolism
nar00340  Histidine metabolism
nar00380  Tryptophan metabolism
nar00410  beta-Alanine metabolism
nar00561  Glycerolipid metabolism
nar00620  Pyruvate metabolism
nar00625  Chloroalkane and chloroalkene degradation
nar00770  Pantothenate and CoA biosynthesis
nar00903  Limonene and pinene degradation
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_1197
   00053 Ascorbate and aldarate metabolism
    Saro_1197
   00620 Pyruvate metabolism
    Saro_1197
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_1197
   00561 Glycerolipid metabolism
    Saro_1197
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_1197
   00310 Lysine degradation
    Saro_1197
   00330 Arginine and proline metabolism
    Saro_1197
   00340 Histidine metabolism
    Saro_1197
   00380 Tryptophan metabolism
    Saro_1197
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Saro_1197
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Saro_1197
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Saro_1197
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Saro_1197
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Saro_1197
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-ProteinID: ABD25642
UniProt: Q2G931
Position
complement(1245211..1246557)
AA seq 448 aa
MTAPTAADLSADIARVFALQQAHMWEAKASTAAERKEKLARLKAAVEAHADDIVAAVLED
TRKPVGEIRVTEVLNVTANIQRNIDNLDEWMKPVEVATSLNPADRAQIIHEARGVCLILG
PWNFPLGLALGPVAAAIAAGNTCIVKLTDLCPATARVASVIVREAFDEKDVALFEGDVSV
ATALLDLPFNHVFFTGSPRVGKIVMAAAAKHLTSVTLELGGKSPVIVDDSADIDQVAAQL
AAAKQFNGGQACISPDYVFVKEDKKAALVEGFRANVQKNLYDDAGNLKKDSIAQVVNKAN
FDRVKAMFDDAVAKGATVAAGGTFEADDLTIHPTMLTGVTPQMTILQDEIFAPVIPVMTY
DTLDQAIGYIEARDKPLALYVYSKDEANVEKVLARTSSGGVTVNGVFSHYLENNLPFGGV
NTSGMGSYHGVFGFKCFSHERAVYRHQQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgactgccccgaccgccgccgacctttccgccgacatcgcacgcgtcttcgcactccag
caggcgcacatgtgggaggccaaggcctccaccgcggccgagcgcaaggaaaagctcgcg
cgcctcaaggccgccgtcgaagcccacgccgacgacatcgtcgccgccgtcctcgaagac
acgcgcaagccggttggcgaaatccgcgtgaccgaagtcctcaacgtcaccgccaacatc
cagcgcaacatcgacaatctcgatgaatggatgaagccggtcgaggtcgccacctcgctc
aatcccgccgaccgcgcgcagatcatccacgaagcgcgcggcgtctgcctgatccttggc
ccctggaacttccccctcggcctcgcgctcggtccggtcgccgctgccatcgccgcaggc
aacacctgcatcgtgaagctcaccgacctctgccccgccaccgcaagggtggcctcggtg
atcgtcagggaagcgttcgacgaaaaggatgtggctctgttcgaaggcgacgtctcggtc
gccaccgcgctcctcgatctgccgttcaaccacgtcttcttcaccggctcgccccgcgtc
ggcaagatcgtgatggccgctgccgcaaagcacctcaccagcgtcacgctcgaacttggc
gggaagtcgcccgtcatcgtcgacgatagcgccgacatcgatcaggtcgccgcccagctc
gccgcggccaagcagttcaacggcgggcaggcctgcatcagcccggactacgtcttcgtg
aaggaagacaagaaggccgcgctggtcgaaggcttccgggccaacgtgcagaagaacctc
tatgacgatgccggcaacctgaagaaggacagcatcgcccaggtggtcaacaaggcgaac
ttcgaccgcgtgaaggccatgttcgacgatgccgtcgccaagggcgcgaccgtcgccgcc
ggcggaacgttcgaagccgatgacctcaccatccatccgaccatgctgaccggcgtcacc
ccgcagatgaccatcctccaggacgaaatcttcgcccccgtcatcccggtgatgacctac
gacacgctcgaccaggcgatcggctacatcgaagcccgcgacaagccgctcgcactctat
gtctacagcaaggacgaagcgaacgtcgaaaaggtcctcgcccgcacctcgtcgggcggt
gtcacggtgaatggcgtgttctcgcactacctggaaaacaacctgccgttcggcggcgtc
aacaccagcggcatgggcagctaccacggcgtgttcggcttcaagtgcttcagccacgaa
cgggctgtctaccgccaccagcagtaa

KEGG   Novosphingobium aromaticivorans: Saro_2599
Entry
Saro_2599         CDS       T00322                                 

Name
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00053  Ascorbate and aldarate metabolism
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00330  Arginine and proline metabolism
nar00340  Histidine metabolism
nar00380  Tryptophan metabolism
nar00410  beta-Alanine metabolism
nar00561  Glycerolipid metabolism
nar00620  Pyruvate metabolism
nar00625  Chloroalkane and chloroalkene degradation
nar00770  Pantothenate and CoA biosynthesis
nar00903  Limonene and pinene degradation
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_2599
   00053 Ascorbate and aldarate metabolism
    Saro_2599
   00620 Pyruvate metabolism
    Saro_2599
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_2599
   00561 Glycerolipid metabolism
    Saro_2599
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_2599
   00310 Lysine degradation
    Saro_2599
   00330 Arginine and proline metabolism
    Saro_2599
   00340 Histidine metabolism
    Saro_2599
   00380 Tryptophan metabolism
    Saro_2599
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Saro_2599
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Saro_2599
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Saro_2599
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Saro_2599
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Saro_2599
SSDB
Motif
Pfam: Aldedh OmdA Nsp2_AV
Other DBs
NCBI-ProteinID: ABD27035
UniProt: Q2G538
Position
2807327..2808745
AA seq 472 aa
MADATRFYIGGEWVAPSTSVTTDIVNPANRSVVGQVALGGPADAEAAIAAARAAFPAWSA
TTREHRLAVLERINAALIARADEIGDAIMAEMGAPLGLARGAQAGSGPQHFEETIRVLKD
YAFETPLGTTLLQREAIGVCVLITPWNWPMNQIATKVAPALAAGCTMILKPSEVAPLDAA
ILAEIIDEAGLPDGVFNLVHGTGPGIGDALTGHPDVDMVSFTGSTRAGIAIAANAAPTIK
RVALELGGKSANILLPDADLAKAVPASVRGCMLNTGQSCNAPTRLLVPRTTLSRVEHLAR
EAAEAIVVGMPTDNPHMGPVANEAQYRRVIALIEQACHEGTQLLCGGVEPPKSLEHGLFV
APTIFTDVAPDATIAREEVFGPVLAIIPYETVDEAIEIANDSPYGLSGYVWGDPDAARNV
ARRMRTGMVHVNGASLDSAAPFGGYRMSGNGREWGVWGLEEFLEVKSIYGGA
NT seq 1419 nt   +upstreamnt  +downstreamnt
gtggccgacgcaacgcggttctacatcggcggcgaatgggtcgccccttcgacgagcgtg
acgacagacatcgtcaatccggcgaaccggtcggttgtaggccaggtcgcgcttggcgga
ccggccgatgccgaggcggccattgccgctgcaagggctgcgtttccggcctggtcggcc
acgacccgcgagcatcggcttgcggtcctcgaacggatcaatgccgcgctcatcgcccgc
gccgacgagatcggcgatgcgatcatggcggaaatgggggcgcccctgggccttgcgcgc
ggcgcgcaggcgggatcggggccgcagcatttcgaagagacgatccgcgtcctgaaggac
tacgccttcgaaacgccgctcggcacgaccctgctccagcgcgaggccattggcgtgtgc
gtgctcataacgccgtggaactggcccatgaaccagatcgcgaccaaggttgcgccagcg
cttgccgccggatgcaccatgatcctgaagccaagcgaagtcgcaccgctcgacgccgcg
attctggccgagatcatcgacgaggccggcctgccggacggcgtgttcaaccttgtgcat
ggcacggggcccggaatcggcgatgcgctgaccgggcatcccgatgtcgacatggtcagc
ttcaccggatcgacccgcgcggggatcgccatagcagccaatgccgcaccgacgatcaag
cgcgtggcgctggaactgggcggcaagagcgcgaacatcctgctgccggacgccgatctg
gcaaaggccgtcccggccagcgtgcgcggctgcatgctgaacaccgggcagagctgcaat
gctccgacgcgcctgctcgtaccgcgcaccaccctctcgcgcgtcgagcatctggcaagg
gaagcggcggaggcaatcgtcgtgggcatgccgacagacaatccccacatgggcccggta
gccaacgaggcccagtatcgccgtgtcatcgcactgatcgagcaggcgtgccacgaaggc
acgcagctgctgtgcggcggcgtggagccgcccaagagccttgagcatggcctgttcgtc
gcgccgaccattttcacggacgtcgcccccgacgccaccattgcacgcgaggaagtgttc
gggccggtactcgccatcatcccctacgaaaccgtcgacgaggccatcgagatcgccaac
gacagcccctatggcctgtccggatatgtctggggcgaccccgacgccgcgcgcaacgtg
gcgcggcggatgcggacggggatggtccacgtcaacggcgcgtcgctcgacagcgcagcg
cctttcggtggctaccggatgtcgggcaacggccgcgaatggggcgtctggggcctggag
gagttcctcgaggtgaagtccatctacggcggcgcctga

KEGG   Novosphingobium aromaticivorans: Saro_2801
Entry
Saro_2801         CDS       T00322                                 

Name
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00053  Ascorbate and aldarate metabolism
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00330  Arginine and proline metabolism
nar00340  Histidine metabolism
nar00380  Tryptophan metabolism
nar00410  beta-Alanine metabolism
nar00561  Glycerolipid metabolism
nar00620  Pyruvate metabolism
nar00625  Chloroalkane and chloroalkene degradation
nar00770  Pantothenate and CoA biosynthesis
nar00903  Limonene and pinene degradation
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_2801
   00053 Ascorbate and aldarate metabolism
    Saro_2801
   00620 Pyruvate metabolism
    Saro_2801
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_2801
   00561 Glycerolipid metabolism
    Saro_2801
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_2801
   00310 Lysine degradation
    Saro_2801
   00330 Arginine and proline metabolism
    Saro_2801
   00340 Histidine metabolism
    Saro_2801
   00380 Tryptophan metabolism
    Saro_2801
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Saro_2801
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Saro_2801
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Saro_2801
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Saro_2801
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Saro_2801
SSDB
Motif
Pfam: Aldedh HCV_NS4a
Other DBs
NCBI-ProteinID: ABD27237
UniProt: Q2G4I6
Position
complement(3024456..3025925)
AA seq 489 aa
MTPEGVNVAHPDKLYIAGRWVPAHSGRMIELVSPNTELVVGRVAEADETDMDAAVAAARD
AFDHGPWPTTPPAERIAAFRRMVAHLETRVPELAKAWTAQMGGLASFAGPMHGGSVMALG
QIAGFAEKFEFVERRPSMAADTALIAYEPVGVVAAIAPWNGPFGIMANKVAYALLTGCTV
IMKPSPETPLEAYIIAEAAEAAGIPAGVVNLVTGHREASDHLVCNEGVDKVSFTGSTVAG
KRIASVCGSRMARCTLELGGKSAAIVRDDFPIDAAAKMLAGTITMMSGQVCAMLSRVIVP
RRRHDELAEAIAAEMKKVRIGNSDDPETQLGPVAMKRQLERIEMYIEEGRKTADLVTGGG
RPAHLNRGYFIEPTLFANVRNESRIAQEEIFGPVLSLIPVEDEEDAIRTANASAYGLNGS
VLTNDAEAAYRIARRVRTGGFGQNGLRMDFGLPFGGFKQSGIGREGGPEGLFPYLEMKTI
LIDGMPSAL
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgacacccgaaggcgtgaacgtagcccatcccgacaagctctacatcgccggccgctgg
gtgccggcgcattcggggcggatgatcgaactggtctcgcccaacaccgagctggtggtg
ggccgggttgccgaagccgacgagacggacatggacgccgccgttgccgccgcgcgtgat
gccttcgatcacgggccatggccaaccacgcctccggccgagcgcatcgccgcattccgg
cgaatggtcgcgcaccttgaaacgcgcgtgcccgaactggcgaaggcgtggaccgcgcag
atgggcgggctcgcctcgttcgcggggccgatgcacggcggcagcgtgatggcgctgggc
cagattgcggggtttgcggaaaagttcgagttcgtcgagcgccgcccgagcatggccgcc
gataccgcgctgatcgcctatgagccggttggggtcgtggcagcgatcgcgccgtggaac
gggccgttcgggatcatggcgaacaaggtcgcctatgccctgctgaccggctgcacggtg
atcatgaagccgtcgcccgaaacgccgctggaagcctatatcatcgccgaggcggccgag
gcggctggtattccggccggcgtcgtcaatcttgtgacgggacaccgcgaggcgagcgat
caccttgtctgtaacgaaggcgtcgacaaggtgagtttcaccggatcgaccgtggccggc
aagcgcatcgccagcgtttgcggttcgcgcatggcgcgctgcacgctggaactgggcggc
aagtcggcagccatcgtgcgggacgatttccccatcgatgccgccgcgaagatgctggcg
gggacgatcacgatgatgtcgggccaggtctgtgcgatgctcagccgggtcatcgttccg
cgccgccgtcacgatgaactcgccgaggcgatcgcggcggaaatgaagaaggtgcgcata
ggcaattccgacgatcccgagacccagctcggcccggtcgcgatgaagcggcagctcgaa
cggatagagatgtatatcgaggagggccggaagacggccgatctcgtcaccggcggcgga
cgcccggcccatctgaatcgcggctacttcatcgagcccacgcttttcgccaacgtcagg
aacgagagccgcatcgcgcaggaggagattttcggccctgtcctcagcctgatcccggtc
gaggacgaggaggacgccatccgcaccgccaatgccagcgcatatggcctcaacggatcg
gtcctgaccaacgatgccgaagccgcctatcgcatcgcccggcgcgtgcgcaccgggggc
ttcggtcagaacgggctgcgcatggacttcggcctgcccttcggcgggttcaagcaatcc
ggcatcggccgcgaaggcgggccggaagggctcttcccctatctcgaaatgaagaccatc
ctgattgatggcatgccttcggcgctttga

KEGG   Novosphingobium aromaticivorans: Saro_2938
Entry
Saro_2938         CDS       T00322                                 

Name
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00053  Ascorbate and aldarate metabolism
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00330  Arginine and proline metabolism
nar00340  Histidine metabolism
nar00380  Tryptophan metabolism
nar00410  beta-Alanine metabolism
nar00561  Glycerolipid metabolism
nar00620  Pyruvate metabolism
nar00625  Chloroalkane and chloroalkene degradation
nar00770  Pantothenate and CoA biosynthesis
nar00903  Limonene and pinene degradation
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_2938
   00053 Ascorbate and aldarate metabolism
    Saro_2938
   00620 Pyruvate metabolism
    Saro_2938
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_2938
   00561 Glycerolipid metabolism
    Saro_2938
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_2938
   00310 Lysine degradation
    Saro_2938
   00330 Arginine and proline metabolism
    Saro_2938
   00340 Histidine metabolism
    Saro_2938
   00380 Tryptophan metabolism
    Saro_2938
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Saro_2938
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Saro_2938
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Saro_2938
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Saro_2938
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Saro_2938
SSDB
Motif
Pfam: Aldedh LuxC DUF1487
Other DBs
NCBI-ProteinID: ABD27373
UniProt: Q2G450
Position
3154454..3155926
AA seq 490 aa
MTAFDPDSIRPALAANFIGGEAVVGRGRSFEVLRPSDGQLLGELRAADEQQLCAAVENAA
MAQKASGWGAMEPRGRMKLLRRWADLIEADAETLVPLEAVGSSRTLAEVRAWDLPYTAEC
IRFFAEFADKHGGEIAATTPDKLGFTLTEPYGVIGAIAPWNLPLVMAAWKLGPALAAGNA
VVLKPSELTPFSVVRLAELAVAAGIPAGVFNVVQGGGGDIGDALVRHERIAKVSFTGSTR
TGQAIMAACAMTGPKPSTLELGGKSPQIVFADADLAKASALVARAITLNSGQVCVAGSRL
LVHEKARDEVVERLTTAFEAHRLGTTWDAATTMGPIISEGQLATIDGIVQRARAAGAEAV
TGGARAVSPQSGSYYQPTLLAGMSDDNEAVQGEIFGPVLTVQSFADEDEAFALANGTRYG
LAAGVHTTDISRALRAVRALEAGTVWVNRYGRSDDFILPTGGFKQSGVGKDLGREAYLGS
CKVKTALIQI
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgaccgcgttcgatcccgactccattcgccctgcgctggccgccaatttcatcggcggc
gaagcagtcgtcgggcgcggtcgcagcttcgaggtcctgcggccctctgacggccagttg
cttggcgaattgcgcgcggcggacgagcagcagctttgcgcagcggtggagaatgccgcg
atggcgcagaaggccagcgggtggggcgccatggaaccgcgcgggcgaatgaagctgctg
cgccgctgggcggacctgatcgaggccgacgccgaaacgctggtgccgctcgaggcggtc
ggatcgagccgcacgcttgccgaagtccgcgcctgggacctgccctataccgcggaatgc
atccgcttcttcgccgagttcgccgacaagcacggcggcgagatcgccgcgaccacgccg
gacaagctgggcttcacgctgaccgagccatatggcgtgatcggcgccatcgcgccgtgg
aacctgcctttggtgatggcggcatggaaactggggccggccctggcagcaggaaatgcc
gtcgtcctcaagccttccgagctgaccccgttctcggtcgtgcgccttgccgaactggcg
gtcgccgccggcattccggccggggtattcaacgtcgtgcagggcggcgggggcgacatc
ggcgacgcgctggtgcggcacgaacgcatcgcgaaggtaagcttcaccggctcgacccgt
accgggcaggcgatcatggccgcctgcgccatgaccgggcccaagccctccacgctggaa
ctgggcggaaagagcccgcagatcgtctttgccgacgccgaccttgccaaggcgagcgcg
ctggtcgcccgcgcgatcacgctcaactccgggcaggtctgcgtggcgggatcgcgcctc
ctggtccacgagaaggcgcgcgacgaagtggtcgaacgcctgaccaccgcgttcgaagcc
catcgtctgggaacaacgtgggacgccgccacgacgatggggcccatcatttcggaaggc
cagctggcgacgatcgacggcatcgtccagcgcgcccgcgcggccggtgccgaggcggtg
accggcggcgcgcgggccgtgtcgccgcagtcgggcagctattaccagcccactttgctt
gccggcatgagcgacgacaacgaggccgtacagggcgagatcttcggaccggtgctgaca
gtgcaatccttcgccgacgaagacgaggccttcgcgctcgccaatggcacgcgctatggc
cttgccgccggcgtccacacaacggacatctcccgcgcgctgcgggcggtgcgcgccctt
gaggcggggacggtctgggtcaaccgatatggccgctcggatgacttcatcctgccgacc
ggcggcttcaagcagtccggcgtgggcaaggatcttggccgcgaagcctatctcggatcg
tgcaaggtgaagacggcgctgatccagatctga

KEGG   Novosphingobium aromaticivorans: Saro_3700
Entry
Saro_3700         CDS       T00322                                 

Name
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00053  Ascorbate and aldarate metabolism
nar00071  Fatty acid degradation
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00330  Arginine and proline metabolism
nar00340  Histidine metabolism
nar00380  Tryptophan metabolism
nar00410  beta-Alanine metabolism
nar00561  Glycerolipid metabolism
nar00620  Pyruvate metabolism
nar00625  Chloroalkane and chloroalkene degradation
nar00770  Pantothenate and CoA biosynthesis
nar00903  Limonene and pinene degradation
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_3700
   00053 Ascorbate and aldarate metabolism
    Saro_3700
   00620 Pyruvate metabolism
    Saro_3700
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Saro_3700
   00561 Glycerolipid metabolism
    Saro_3700
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Saro_3700
   00310 Lysine degradation
    Saro_3700
   00330 Arginine and proline metabolism
    Saro_3700
   00340 Histidine metabolism
    Saro_3700
   00380 Tryptophan metabolism
    Saro_3700
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Saro_3700
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Saro_3700
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Saro_3700
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Saro_3700
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Saro_3700
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: ABP64559
UniProt: A4XF48
Position
pNL2:complement(334883..336337)
AA seq 484 aa
MKAGPMEMNACERLYIDGDWVEPARPAPPIPVINPATEMACGSVRPGSALDVDRAVAAGR
RAFASFSVSPAQERIALLGRILSLMEERAEALAQAVTLEMGCAISFSRTAQVPFGVAHVR
AALKVLHDFPFLTPQGSTAILREPIGVCGLITPWNWPLYQITAKLAPALAAGCTVVLKPS
ELSPFSAALLAQIVHDAGTPAGVFNMVTGTGPGVGEAIAAHGDIDMVSITGSTRAGVLVA
QAAATTVKRVTQELGGKSPNILLDDADFERVVPLGIAAGMRNVGQSCSAPTRMLVPRHRL
TEVEQLAANAANALVVGDPLAEATDLGPVANSRQFDKVQQMIAVGQAEGARLLCGGPGRP
EGLDRGFFCRPTVFTCDDPAMRVAQEEIFGPVICVIPYDDDDHAVRIANDTIYGLGSHVQ
SADIDRARTVAARIRAGQVHINHPAWDGHAAFGGYKQSGNGREYGRFGLEEYLETKAVLG
YFPQ
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgaaggcaggaccgatggaaatgaacgcctgcgagcgcctttacatcgatggcgattgg
gtggaacccgcccgccccgccccgccgatcccggtaatcaatcctgcaaccgaaatggcg
tgcggctcagtcaggcccggaagcgcgctcgatgtcgatcgcgcggtggcagcggggcgc
cgggcatttgcgtcattctccgtgagccctgcgcaggagcgtattgccctgctcggcaga
attctctccctgatggaggaaagggcggaagctctcgctcaggccgtcacgctggaaatg
gggtgcgcaatctcgttttctcgtacggctcaggtacctttcggtgtcgcccatgttcgc
gcagcactcaaagtgctgcatgacttcccgttcctcactccacagggttccaccgcgatc
ctgcgtgaacccatcggcgtctgcgggctcatcacgccgtggaactggccgctgtaccag
atcacggcgaagcttgcgccggcgcttgccgcagggtgcaccgttgtgttgaagcccagc
gagctgtcgccgttcagcgcggcgctgctggcgcagatcgtccacgatgccggcacaccg
gctggcgtattcaacatggtgaccggcaccggccccggggtgggagaggccatcgctgcg
catggcgacatcgacatggtctcgataaccggctcgacgcgtgcgggtgtgcttgtcgcc
caggctgccgcgaccacggtaaagcgggtaacgcaggagctaggtggcaagtcgccgaac
atcctgctcgacgatgccgatttcgagcgggtcgttcccctaggcatcgcggcgggcatg
cgcaacgtcggccagtcctgcagcgcgccgacgcgcatgctggtgccgcgccatcgcctg
accgaagtggagcagcttgccgcgaatgccgccaacgcgctcgttgtcggggatccgctg
gccgaagcgacggacctcggaccggttgccaacagccgccagttcgacaaggtccaacag
atgatcgccgtcggccaggccgaaggcgcccgtctgctgtgtggcggccccggcaggccc
gaagggctggatcgcggcttcttctgcaggccgacggtattcacctgcgatgatccggcg
atgcgcgtagcgcaggaggagatcttcgggccggtgatctgcgtgatcccctacgacgat
gacgaccacgccgtccgcattgccaatgacacgatctacgggctcggctcgcacgtccag
tccgcagatatcgaccgcgcacgaactgtggcggcaaggatccgggcggggcaggtccac
atcaaccatcccgcctgggacgggcatgcagccttcggcggttacaagcagtctggaaac
gggcgtgaatatgggcgtttcggcctggaggaatacctcgagaccaaggccgttctggga
tacttcccccagtga

DBGET integrated database retrieval system