KEGG   Novosphingobium aromaticivorans: Saro_1178
Entry
Saro_1178         CDS       T00322                                 

Name
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00020  Citrate cycle (TCA cycle)
nar00260  Glycine, serine and threonine metabolism
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00640  Propanoate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01240  Biosynthesis of cofactors
Module
nar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_1178
   00020 Citrate cycle (TCA cycle)
    Saro_1178
   00620 Pyruvate metabolism
    Saro_1178
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_1178
   00640 Propanoate metabolism
    Saro_1178
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saro_1178
   00280 Valine, leucine and isoleucine degradation
    Saro_1178
   00310 Lysine degradation
    Saro_1178
   00380 Tryptophan metabolism
    Saro_1178
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_1178
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Saro_1178
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Saro_1178
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 HI0933_like FAD_oxidored GIDA K_oxygenase NAD_binding_8 AlaDh_PNT_C FAD_binding_3 3HCDH_N
Other DBs
NCBI-ProteinID: ABD25623
UniProt: Q2G950
Position
complement(1217118..1218518)
AA seq 466 aa
MAEYDYDVLFIGAGPGGYVGAIRTAQLGLKTACAEGRETLGGTCLNVGCIPSKALLHGSE
KFDEARNGTFASYGIKTGAVELDLDAMQAQKADSVKSLTGGIEFLFKKNKVTWLKGYAAF
EDAHTVTVAGQKVTAKNIVIATGSSVTPLPGVTVDNDAGVIVDSTGALALNRVPQHLVVI
GGGVIGLELGSVWRRLGAKVTVVEFLDQLLPGMDGDVRKEAAKIFKKQGMELKLGTKVTG
VAVNGGTATLTVEPSKGGEASTIEADCVLVAIGRRPNVDGLGLDKIGLELNARGQIETDH
DFATKIPGVWAIGDVIPGPMLAHKAEDEGIAVAENIAGLTGIVNHDVIPGVVYTMPEFAG
VGLTEEAAKERGEIKVGKFPMLANSRAKTNHEPDGFVKVISDAKTDRVLGVWCIASVAGT
MIAQAAQAMEFGATSEDIAYTCHAHPTHSEALKEAAMAVTGKPIHM
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggctgaatacgattacgacgttcttttcatcggtgccggtcccggcggttatgtcgga
gccatccgcacggcgcagctcggactgaagacggcttgcgccgaagggcgcgagacgctg
ggcgggacctgcctgaacgtcgggtgcattccgtcgaaggcgctgctgcacggttccgag
aagttcgacgaagccaggaacggcactttcgccagctatggcatcaagaccggcgcggtc
gaactcgacctcgacgcgatgcaggcgcagaaggcggattcggtaaagagcctgacgggc
ggcatcgagttcctgttcaagaagaacaaggtgacctggctcaagggctatgccgcgttc
gaggacgcgcacacggtgaccgtcgccggccagaaggtgaccgcgaagaacatcgtcatc
gccaccggttcgagcgtgaccccgctgccgggcgtgaccgtggacaacgacgcgggcgtg
atcgtggacagcactggcgcactggcgctgaaccgcgtgccgcagcacctggtggtgatc
ggcggcggcgtgatcgggcttgagctgggttcggtgtggcgtcgcctgggcgcgaaggtc
accgtggtcgaattcctcgaccagttgctgcccggcatggacggcgacgttcgcaaggaa
gcggccaagatcttcaagaagcagggcatggagctgaagctcggcaccaaggtgacgggc
gttgcggtgaatggcgggacggcgacgctgaccgtcgaaccatcgaagggcggcgaagcg
tcgacgatcgaggccgactgcgtgctggtcgccattggccgccgtcccaacgtggacggc
ctcgggctcgacaagatcggacttgaactgaacgcacgcgggcagatcgagaccgaccac
gactttgccacgaagatccccggcgtatgggcgatcggcgacgtgatccccggcccgatg
ctggcgcacaaggccgaggacgaaggcatcgccgtggccgagaacatcgcagggcttacc
ggcatcgtgaaccatgacgtgatcccgggtgtggtctacaccatgccggagttcgcgggc
gtggggcttacggaagaagcggccaaggaacgcggcgagatcaaggttggcaagtttccg
atgctggccaacagccgcgcaaagaccaaccacgagccggacggtttcgtgaaggtcatt
tccgacgccaagaccgaccgcgtgctgggcgtgtggtgcatcgcgagcgttgccggcacg
atgatcgcgcaggcggcgcaagccatggaattcggcgcgacaagcgaagacatcgcctat
acctgccatgcgcacccgacccattcggaagcgctgaaggaagccgccatggcggtcacg
ggcaagccgatccacatgtga

KEGG   Novosphingobium aromaticivorans: Saro_1945
Entry
Saro_1945         CDS       T00322                                 

Name
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00010  Glycolysis / Gluconeogenesis
nar00020  Citrate cycle (TCA cycle)
nar00260  Glycine, serine and threonine metabolism
nar00280  Valine, leucine and isoleucine degradation
nar00310  Lysine degradation
nar00380  Tryptophan metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00640  Propanoate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01240  Biosynthesis of cofactors
Module
nar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saro_1945
   00020 Citrate cycle (TCA cycle)
    Saro_1945
   00620 Pyruvate metabolism
    Saro_1945
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_1945
   00640 Propanoate metabolism
    Saro_1945
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saro_1945
   00280 Valine, leucine and isoleucine degradation
    Saro_1945
   00310 Lysine degradation
    Saro_1945
   00380 Tryptophan metabolism
    Saro_1945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nar04147]
    Saro_1945
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Saro_1945
Exosome [BR:nar04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Saro_1945
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 GIDA FAD_oxidored NAD_binding_8 HI0933_like FAD_binding_3 K_oxygenase Thi4 AlaDh_PNT_C 2-Hacid_dh_C GMC_oxred_N 3HCDH_N Lycopene_cycl UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: ABD26385
UniProt: Q2G6Y8
Position
complement(2060883..2062295)
AA seq 470 aa
MAEQYDVIVLGSGPGGYVAAIRCAQLGLKTAIVERENLGGICLNWGCIPTKALLRSAEVL
NHMKHAAAYGLAADNIRADLDAVVKRSRGVAKQLNQGVTHLMKKNKITVHMGNGILKSAT
SVEVTGDKGSETISAKHVIVATGARARDLPFAKADGERVWTYRHAMTPKEMPTKLLVIGS
GAIGIEFASFYNDMGAEVTVVEMMDRVVPVEDADVSAFLEKALTKQGMKIMTGAGVESLA
VSASGVKAKIKGKDGKVAEGDYSHVIVAVGIVPNTEHIGLEALGVKAERGIIAIDGYGRT
NVKGLWAIGDVTPGPWLAHKASHEGVIAAEAIAAELGNKEVHPHPMDRGNIPGCTYCHPQ
IASVGLTEAKAKEAGYAVKVGTFPFIGNGKAIALGEPEGFVKTVFDAKTGELLGAHMIGA
EVTEMIQGYVVGKTLETTEAELMHTVFPHPTISESMHESVLAAYGRAIHI
NT seq 1413 nt   +upstreamnt  +downstreamnt
gtggctgaacagtatgacgtcatcgtcctcggatcgggccccggcggctatgtcgcggcg
atccgctgcgcccagcttggcctgaagacggccatcgtcgagcgcgagaacctcggcggc
atctgccttaactggggttgtatcccgaccaaggcgctcctgcgctcggccgaagtgctg
aaccatatgaagcatgccgccgcctacggtcttgcggccgacaacatccgtgcggacctc
gacgcggtggtcaagcggtcccgcggagttgccaagcagctcaaccagggcgtcacgcac
ctgatgaagaagaacaagattaccgtgcacatgggcaacggtattctgaagtcggccacg
tcggtggaagtcactggcgacaagggttccgaaaccatctcggccaagcatgtgatcgtc
gccaccggagcccgcgcccgcgacttgccgttcgccaaggccgacggcgagcgcgtgtgg
acctatcgccacgcgatgacgcccaaggagatgccaaccaagcttctggtcatcggatcg
ggtgcgatcggcatagaatttgccagcttctacaatgatatgggggcagaagttactgtc
gtcgagatgatggaccgggtggtgcccgtggaagatgccgacgtttcggccttcctcgaa
aaggcgctaaccaagcagggcatgaagatcatgaccggcgcaggcgtcgaaagcctggcc
gtttcggcctcgggcgtgaaggcgaagatcaagggcaaggatggcaaggtcgcggaaggc
gattacagccatgtcatcgttgcggtcggcatcgtgccgaataccgagcacatcggcctc
gaagcgctgggggtgaaggctgagcgcgggatcatcgccatcgacggttatggccgcacg
aacgtcaagggcctgtgggccatcggcgacgttacgccggggccatggctggcgcacaag
gccagccatgaaggcgtgatcgctgctgaggccatcgccgcggaactgggcaacaaggag
gttcacccgcacccgatggaccgggggaacatcccgggatgcacctactgtcacccgcag
atcgcaagcgtcggcctgaccgaggccaaggccaaggaagcaggctacgcggtgaaggtc
gggaccttccccttcatcggcaatggcaaggctatcgcgctgggcgagcccgagggcttc
gtgaagaccgtgttcgatgccaagaccggcgaattgctcggtgcgcacatgatcggcgct
gaagtgaccgagatgattcaaggctatgtggtcggcaagacgctggagacgacagaggcc
gaactgatgcacacggtgttcccgcatccgaccatcagcgaatcgatgcacgaaagcgtt
ctggctgcttacggacgcgccatccacatctga

DBGET integrated database retrieval system