KEGG   Novosphingobium aromaticivorans: Saro_1182
Entry
Saro_1182         CDS       T00322                                 

Name
(GenBank) malate dehydrogenase (NAD)
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00020  Citrate cycle (TCA cycle)
nar00270  Cysteine and methionine metabolism
nar00620  Pyruvate metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00680  Methane metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
Module
nar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nar_M00012  Glyoxylate cycle
nar_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Saro_1182
   00620 Pyruvate metabolism
    Saro_1182
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_1182
  09102 Energy metabolism
   00680 Methane metabolism
    Saro_1182
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Saro_1182
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Saro_1182
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 F420_oxidored ThiF
Other DBs
NCBI-ProteinID: ABD25627
UniProt: Q2G946
Position
complement(1223941..1224903)
AA seq 320 aa
MARKKIALIGAGNIGGTLAHLAAQKELGDIVLFDVVEGVPQGKALDLSQCGPVEGFDANI
IGTNDYKGIAGADVIIVTAGVARKPGMSRDDLLGINLKVMKAVGEGIRDNAPDAFVICIT
NPLDAMVWALREFSGLPANKVVGMAGVLDSARFSTFLAWEFGVSIRDVNTFVLGGHGDTM
VPVTQYSTVNGIPVPDLVKMGLSTQEKIDAIVQRTRSGGGEIVGLLKTGSAFYAPAASGI
AMAEAYLNDQKRILPCAAYVDGEYGVNGLYVGVPVLIGANGVEKVIEIELDDEAKGNLQV
SVDAVKELLEACKGIDPSLA
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcacgcaagaagatcgcgctgatcggcgcgggcaacatcggtggcactcttgcccac
ctcgccgcccagaaggaacttggcgacatcgtcctgttcgacgtcgttgaaggcgtgccc
cagggcaaggcgctcgacctttcgcagtgcggtccggtcgaaggcttcgacgccaacatc
atcggcaccaacgactacaagggcatcgcaggcgcggacgtgatcatcgtcaccgccggc
gtcgcccgcaagcccggcatgagccgcgacgacctgctcggcatcaacctcaaggtgatg
aaggccgtcggcgaaggcatccgcgacaacgcgcccgacgcgttcgtgatctgcatcacc
aacccgctcgacgcgatggtctgggcgctgcgcgagttctcgggcctgcccgcgaacaag
gtcgtcggcatggccggcgtgctcgactcggcgcgcttcagcacgttcctggcatgggaa
ttcggcgtctcgatccgcgacgtgaacacgttcgttctcggcggccacggcgacaccatg
gttccggtcacccagtactcgaccgtcaacggcatcccggtgcccgacctcgtcaagatg
ggcctgtccacccaggaaaagatcgacgcgatcgtgcagcgcacccgttcgggcggcggc
gagatcgtcgggctgctcaagaccggttcggcgttctacgcgcctgccgcatcgggcatc
gcgatggccgaagcctatctcaacgaccagaagcgcatcctgccctgcgccgcctacgtt
gacggcgaatacggcgtgaacggtctttacgtcggcgtgccggtgctgatcggcgcgaac
ggcgtcgagaaggtgatcgagatcgaactcgacgacgaagccaagggcaacctccaggtc
tccgtcgacgcggtcaaggaactgctggaagcctgcaagggcatcgaccccagcctcgcc
tga

DBGET integrated database retrieval system