KEGG   Novosphingobium aromaticivorans: Saro_1300
Entry
Saro_1300         CDS       T00322                                 

Name
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00061  Fatty acid biosynthesis
nar00620  Pyruvate metabolism
nar00640  Propanoate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
Module
nar_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_1300
   00640 Propanoate metabolism
    Saro_1300
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Saro_1300
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Saro_1300
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Saro_1300
SSDB
Motif
Pfam: Carboxyl_trans zf-ACC Tmemb_55A Auto_anti-p27
Other DBs
NCBI-ProteinID: ABD25744
UniProt: Q2G8S9
Position
complement(1345413..1346264)
AA seq 283 aa
MSWLNKVRNALPFTPKRDTPDNLWIKCPSCSEMLFTKEYEDNLSVCPHCDHHGRIGANAR
LEQLLDAGYELLPAPKVKEDPLKFRDTKKYVDRIKAARAANPHPDALTNAFGRIEGQKAV
VGVQEFAFMGGSMGMAVGNAFVAGTERAIKEKCPYVAVTAAGGARMQEGILSLMQMPRST
VAISRLHAAGLPYIVVLTDPTTGGVTASYAMLGDVQIAEPGALIGFAGQRVIQDTIREKL
PEGFQRAEYLHAHGMIDMVTHRRDLKTTLAQVIDFLMAGKAAA
NT seq 852 nt   +upstreamnt  +downstreamnt
atgagctggctcaacaaggtccgcaacgccctccccttcacgccgaagcgggacacgccg
gacaacctgtggatcaagtgcccttcgtgcagcgagatgctgttcaccaaggagtacgag
gacaatctctcggtctgcccgcactgcgaccatcacggtcgcatcggtgccaacgcacgg
ctcgaacagctgctcgatgccgggtacgagctgcttcccgcccccaaggtcaaggaagac
ccgctcaagttccgcgacaccaagaagtacgtcgaccgcatcaaggcggcccgcgccgca
aacccccatcccgatgcgctgaccaatgccttcggccgcatcgaaggccagaaggctgtc
gtcggcgtgcaggaatttgccttcatgggcggttccatgggcatggcggtcggcaatgcc
ttcgttgccggcaccgagcgggcgatcaaggaaaagtgcccctacgttgccgtcaccgcc
gctggcggcgcgcgcatgcaggagggcatcctcagcctcatgcagatgccgcgctcgacg
gtcgcgatctcgcgtctccatgccgctggcctgccctacatcgtcgtgctgaccgatccc
accacgggcggcgtcacggccagctatgccatgctgggcgacgtccagatcgcggaaccc
ggcgcgctcatcggctttgccggccagcgcgtcatccaggacacgatccgcgaaaagctg
cccgaaggcttccagcgcgccgagtacctccacgctcatggcatgatcgacatggtcacc
caccgccgcgacctcaagaccaccctggcgcaggtcatcgacttcctcatggcgggcaag
gcggcggcgtga

KEGG   Novosphingobium aromaticivorans: Saro_1860
Entry
Saro_1860         CDS       T00322                                 

Name
(GenBank) Carbamoyl-phosphate synthase L chain, ATP-binding protein
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00061  Fatty acid biosynthesis
nar00620  Pyruvate metabolism
nar00640  Propanoate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
Module
nar_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_1860
   00640 Propanoate metabolism
    Saro_1860
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Saro_1860
Enzymes [BR:nar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Saro_1860
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Saro_1860
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp_3 ATP-grasp LAL_C2 DUF3182 MR_MLE_C THF_DHG_CYH_C
Other DBs
NCBI-ProteinID: ABD26300
UniProt: Q2G773
Position
complement(1960982..1962316)
AA seq 444 aa
MIRKLFIANRGEIALRVIRTARAMGIETVLGASEADASSLPAKLADHVAIVGPGPSSQGY
LSIERVVDAAVRSGCDAVHPGYGFLSENAGFARAVAAAGIRFVGPDIATLEGMGDKLAAR
ALAVEAGLPVLPGGEAATRADVHARATETGYPLLLKAVAGGGGKGMRRVDRPEDLDAALD
MAQAEAQAAFGNGAVYVERFVARGRHVEVQLLGDGTNAIHLGTRDCSIQRRFQKLVEEAP
APAMPLASREGIEQAAVRLARHLGYRGAGTAEFLVDAEDFSFYFLELNARIQVEHPVTEA
ITGVDLVEQQLLVAMGKPLSLTQAMVRPNGHAIEVRINAEDPDADFRPSPGRATRAAWPA
GEGVRVDTHIGLGGEVPPFYDSLMGKLIVHGATREQAVERLRKALDSLHIEGLPTTAPLH
RRIVLDPRFVAGGVDTGFLTGLAQ
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgatccgcaagctgttcatcgccaatcgcggagagatcgctctccgcgtgatccgcacc
gcgcgcgccatggggatcgaaaccgtccttggcgcatccgaggccgatgcctcctcgctc
ccggccaagcttgccgaccacgttgcgatcgtcggccccggcccctcgtcgcagggctat
ctgtcgattgaacgcgtcgtcgatgcagcggtcaggtccggctgcgacgcggtccacccg
ggctatggcttcctttccgaaaacgccggtttcgcccgtgcggtcgctgccgccggcatc
cgcttcgtcgggccggacatcgcgacgctcgaaggcatgggcgacaagctcgctgcccgc
gctctcgcggtcgaggcgggcctgcccgtcctccccggcggcgaggccgcgacccgcgcc
gatgtccacgcccgcgccacggagaccggctacccgctcctgctcaaggcggttgcgggc
ggcggcggcaagggcatgcgccgggttgaccgacccgaagacctcgatgccgcgctcgac
atggcccaggccgaagcgcaggccgcgttcggcaacggcgcggtctatgtcgaacgcttc
gtcgcgcgcggacgccatgttgaagtccagcttcttggcgacggaaccaacgccatccat
ctcggcacgcgcgactgctcgatccagcgccgattccagaagctcgtcgaggaagcaccc
gctcccgccatgccgctcgcctcgcgcgagggcatcgaacaggccgcggtccgcctcgcc
cgtcatctcggctatcgcggcgccggcactgccgagttcctcgtcgatgccgaggacttc
tcgttctatttcctcgaactcaacgcgcgcatccaggttgagcatccggtgaccgaggcg
atcaccggcgtcgacctcgtcgagcaacagcttcttgtcgccatgggcaagcccctgtcg
ctgacccaggcgatggtccgccccaacgggcatgccatcgaggtgcgcataaacgccgaa
gatcccgacgcggacttccgcccctcccccggccgcgcaacccgcgccgcctggcccgca
ggcgaaggcgtccgggtagacacccacatcggcctcgggggtgaagtgccgccgttctac
gattcgctcatgggcaagctcatcgtccacggcgcaacccgcgaacaggcggtcgagcgc
cttcgcaaggctctggattcactgcacatcgaaggcctgccgaccaccgcaccgctccac
cgccgcatcgtcctcgacccgcgcttcgtcgccggcggggtcgacaccggcttcctgaca
ggacttgcccaatga

KEGG   Novosphingobium aromaticivorans: Saro_1861
Entry
Saro_1861         CDS       T00322                                 

Name
(GenBank) biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00061  Fatty acid biosynthesis
nar00620  Pyruvate metabolism
nar00640  Propanoate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
Module
nar_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_1861
   00640 Propanoate metabolism
    Saro_1861
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Saro_1861
SSDB
Motif
Pfam: Biotin_lipoyl DUF2486 RnfC_N
Other DBs
NCBI-ProteinID: ABD26301
UniProt: Q2G772
Position
complement(1962318..1962761)
AA seq 147 aa
MTDDLPLTHEDIAEIAAILEKSGYRELDLATRRFRLKVARGDGGDGVTQEWQWAGSAADV
VAESAATEADPDAICSPLPGTFYHAPQPGAPPFVQPGDVVGPETVIGIVETMKLMNPVHA
GRSGTVGAMLVPNGTLVAKGEALVRLT
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaccgacgacctgcccctgacccacgaagacattgccgagatcgccgcgattctcgaa
aagtcgggctatcgcgaactcgatctcgccacccgccgcttccgcctcaaggtcgccagg
ggcgatggcggcgacggcgtcacgcaggaatggcaatgggcaggatcggctgccgatgtc
gttgccgaaagcgcagccaccgaagccgaccccgatgccatctgttcgccgcttccgggc
accttctaccacgcaccgcagcccggcgcgccgcctttcgtccagcccggcgatgtcgtc
ggccctgaaaccgtcatcggcattgtcgagacgatgaagctgatgaacccggtccatgcc
gggcgcagcggcacggtcggcgcgatgctggtccccaacggaacgcttgtcgccaagggc
gaagcgctggtccggctgacctga

KEGG   Novosphingobium aromaticivorans: Saro_1903
Entry
Saro_1903         CDS       T00322                                 

Name
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00061  Fatty acid biosynthesis
nar00620  Pyruvate metabolism
nar00640  Propanoate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
Module
nar_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_1903
   00640 Propanoate metabolism
    Saro_1903
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Saro_1903
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Saro_1903
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Saro_1903
SSDB
Motif
Pfam: ACCA Carboxyl_trans SSI
Other DBs
NCBI-ProteinID: ABD26343
UniProt: Q2G730
Position
2016196..2017146
AA seq 316 aa
MPMISYLEFEKPVAALEARIAELRETAQNGDIDIASEIRRLENKSAELLASTYKALTPWQ
KTQVARHPARPHFKDYVDAIFSDFMPLGGDRLYGEDQAIVGGFARLGTRRVMLIGHEKGN
DTQSRIRHNFGMGKPEGYRKAVRLMEMASRFGLPVVTLVDTSGAFPGVEAEERGQAEAIA
RSTEACLALGVPMVATIVGEGGSGGAVALASAERVLMLEHAVYSVISPEGCASILWRTSE
RAADAAEAMKVTAQDLLALGVIDRIVREPVGGAHRDPDAACAALGNAIGEELDNLAGKSA
DELRALRAERFLRIGA
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcccatgatttcctatctcgagttcgaaaagccggttgccgcgctcgaagcccgcatc
gccgaactgcgcgagaccgcgcagaacggcgatatcgatattgcctccgagattcgcagg
ctcgaaaacaagtccgcagaactgctggccagcacctacaaggcgctgacgccctggcag
aagacgcaagtcgcaaggcaccccgcgcgtcctcacttcaaggactatgtggacgcaatc
ttctcggatttcatgcctttgggcggcgatcgtctttatggcgaggatcaggccatcgtc
ggcgggttcgcccggctcggaacgcggcgggtcatgttgatcggtcacgagaagggcaac
gacacccaaagccgcattcgccacaatttcggcatgggcaagccagaaggctaccgcaag
gcggtgcgtctcatggagatggcaagccgattcgggcttcctgtcgtcaccctggttgac
acgtctggcgcttttcctggcgtcgaggcggaggaacgcggacaggcagaagccatcgct
cgctcgaccgaggcatgtctggcactgggcgtgcccatggtcgcgacgatcgtaggcgaa
ggcgggtctggtggcgctgttgccctggccagtgccgagcgcgtcctcatgctggaacac
gcggtttattcagtgatctcgccggagggttgcgcctcgatcctgtggcgcacctcggaa
cgtgctgcagatgctgcggaggccatgaaggttaccgcccaggacctgctggctctcggc
gtgatcgaccgcatcgtccgcgaacctgtcggcggcgcccatcgcgatcctgacgcggct
tgtgccgcgctcggcaacgccatcggtgaggaactggacaacctggcaggcaagtccgca
gacgagctgcgcgcattgcgcgcggaacggttcctccgaatcggcgcttga

KEGG   Novosphingobium aromaticivorans: Saro_2078
Entry
Saro_2078         CDS       T00322                                 

Name
(GenBank) biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00061  Fatty acid biosynthesis
nar00620  Pyruvate metabolism
nar00640  Propanoate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
Module
nar_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_2078
   00640 Propanoate metabolism
    Saro_2078
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Saro_2078
SSDB
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 RnfC_N NQRA GCV_H HlyD_3 SARG
Other DBs
NCBI-ProteinID: ABD26517
UniProt: Q2G6K6
Position
2216655..2217143
AA seq 162 aa
MGHDRGDKAEKMAIDSKLVRELAELLADTGLSEIEVEDGERKIRVARQLSAAPVAHMVAT
APAPVAAPAPAAAAAAAPAAPAEDHANAVKSPMVGTAYLAAEPGAPNFVSVGQTVKAGET
LLIIEAMKVMNPITAPAAGVVKAILVENAQPVEFDQPLVVIA
NT seq 489 nt   +upstreamnt  +downstreamnt
atggggcacgaccgcggcgataaggccgaaaagatggcgattgacagcaagctggtgcgc
gaactggccgaactgctcgccgataccgggctctccgaaatcgaggtcgaggacggcgag
cgcaagatccgcgtggcccgccagctgagcgctgctccggtcgcccacatggtggcaacc
gcacctgcacccgtcgcggcgcccgcaccggctgccgccgcggcggcggcacctgccgct
ccggcggaagaccatgccaatgccgtgaagtcgcccatggtcggcacggcctatcttgct
gccgaacccggcgcgccgaacttcgtttcggtcggccagactgtgaaggcaggcgaaacc
ctgctcatcatcgaggcgatgaaggtgatgaacccgatcaccgcgccggctgccggcgtc
gtgaaggccatcctcgtcgagaacgcgcagccggtcgaattcgaccagccgctggtcgtg
atcgcgtaa

KEGG   Novosphingobium aromaticivorans: Saro_2079
Entry
Saro_2079         CDS       T00322                                 

Name
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00061  Fatty acid biosynthesis
nar00620  Pyruvate metabolism
nar00640  Propanoate metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01212  Fatty acid metabolism
Module
nar_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saro_2079
   00640 Propanoate metabolism
    Saro_2079
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Saro_2079
Enzymes [BR:nar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Saro_2079
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Saro_2079
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_5 ATPgrasp_ST GARS_A RimK
Other DBs
NCBI-ProteinID: ABD26518
UniProt: Q2G6K5
Position
2217156..2218502
AA seq 448 aa
MAIKRLLIANRGEIALRIHRAAHEMGIETVAVHSTADADAMHVRLADHAVCIGPPAAKDS
YLNVAAIISAAEITHADAIHPGYGFLSENAKFAEIVEAHGITWVGPKPEHIRTMGDKVEA
KRTAGALGLPLVPGSDGAVSEIDEAKKIADAIGYPVIIKAASGGGGRGMKVCNSADQLET
LMQQAGSEAKAAFGDATVYIEKYLGNPRHIEFQIFGDGNGNAIHLGERDCSLQRRHQKVL
EEAPSPVISADERARMGGIVAKAMADMGYRGAGTIEFLWENGEFYFIEMNTRLQVEHPVT
EAITGVDLVREQIRIADGKPLSVTQDEIEFKGHAIECRINAEDPFTFAPSPGLVKSYHAA
GGMHVRVDSGLYAGYKIPPYYDSMIAKLIVYGRTREGCIMRLKRALEEMVIEGPKTSIPL
HQRLLSQPDFLSGDYTIKWLEEWLAKDA
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggccatcaagcgcctgctgatcgccaatcgcggcgagatcgcgctgcgcatccatcgc
gcggctcacgaaatgggcatcgagacggtcgcggtgcactccaccgccgatgccgatgcg
atgcacgtgcgccttgccgaccatgcggtctgcatcggcccgcccgccgcgaaggacagc
tatctcaacgtcgccgcgatcatctcggctgccgagatcacccatgccgacgcgatccat
ccgggctacggcttcctttcggaaaacgccaagttcgcggaaatcgtcgaagcgcacggt
atcacctgggtcggtcccaagccagaacacatccgcacgatgggcgacaaggtcgaggcc
aagcgcaccgcgggcgcgctcggcctgccgctggtccccggttccgacggcgcggtgtcc
gaaatcgacgaggccaagaagatcgccgatgccatcggctatccggtgatcatcaaggca
gcctcgggcggcggcggtcgcggcatgaaggtttgcaacagcgccgaccagctcgaaacg
ctgatgcagcaagccggcagcgaggcgaaggccgcgttcggcgatgccaccgtctatatc
gagaagtatctcggcaacccgcgccacatcgaattccagatcttcggtgacggcaacggc
aacgcgatccacctgggcgagcgcgactgctcgctccagcgccgccaccagaaggtgctc
gaggaagcgccctcgcccgtcatctcggccgacgaacgtgcgcgcatgggcggcatcgtc
gccaaggccatggccgacatggggtatcgcggcgcgggcacgatcgagttcctgtgggag
aacggcgagttctacttcatcgagatgaacacccgccttcaggtggaacatccggtgacc
gaggcgatcaccggcgtcgacctggtgcgcgaacagatccgcattgccgatggcaagccg
ctttcggtcacgcaggacgagatcgagttcaagggacacgcgatcgagtgccgcatcaat
gcggaagacccgttcacatttgccccctcgccgggactggtgaagagctatcacgcagcg
ggcggcatgcacgtgcgcgtcgattcaggtctctacgccgggtacaagatcccgccgtac
tatgactcgatgattgccaagctgatcgtctacggccggacccgcgaaggctgcatcatg
cggctgaagcgcgcgctcgaggaaatggtgatcgaaggccccaagacctcgatcccgctc
caccagcgcctgctgagccagcccgacttcctcagcggcgactacacgatcaagtggctc
gaggaatggctggccaaggacgcctga

DBGET integrated database retrieval system