KEGG   Novosphingobium aromaticivorans: Saro_1850
Entry
Saro_1850         CDS       T00322                                 
Name
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00260  Glycine, serine and threonine metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_1850
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saro_1850
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_1850
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Saro_1850
SSDB
Motif
Pfam: GCV_T GCV_T_C
Other DBs
NCBI-ProteinID: ABD26290
UniProt: Q2G783
Position
1949880..1951046
AA seq 388 aa
MSDTYENPDLDPDVPTGPLALPLDQWHRARGGRMVDFAGYWMPVQYNGEGGGIIAEHLWT
RESAGFFDVSHMGQIYVSGEGAEAALEAILPIDLSTLPLGGARYSLLLNEDGGILDDLMV
TRWGTGFYLVVNGATKWDDIGHLREYLPDEVTLNHLEDNALFALQGPAACAALEPLVKGE
QPLSALTFMRGAAFRLGGVDAWISRSGYTGEDGFEISVPSTKAAELADLICAQPQVKTIG
LGARDSLRLEAGLPLYGHDMTDTVDPVSADLLFGINKRRRNEGGFVGADKVLPLIASGAA
TRRVGLAIEGRMAAREGATVLSNDAEVGTVTSGGFSPSLERPIAMAYVPVDLAAPGTALS
IDVRGRKLAASVVSMPFVPHRYHRKGAA
NT seq 1167 nt   +upstreamnt  +downstreamnt
gtgagcgacacatacgaaaacccagaccttgatcccgacgtgccgaccggtccgttggcc
ctgccgctcgaccagtggcaccgcgcacgcggcggtcgcatggtcgatttcgccggctac
tggatgccggtccaatacaacggagaaggcgggggcatcatcgccgagcatctctggacc
cgcgagagcgccgggtttttcgatgtttcgcacatgggccaaatctacgtttcgggtgaa
ggcgctgaggccgcgctcgaagccatcctgccgatcgacctgtccacgcttccgctcggc
ggggcgcgctactcgctactgctgaacgaagacggcgggatactcgatgacctgatggtc
acgcgctggggcaccggcttctacctggtcgtcaacggcgcgaccaagtgggacgatatc
ggccacctgcgcgaatacctgccggacgaggtgacgctcaaccacctcgaagacaacgcg
ctcttcgcgctccagggcccggccgcctgcgcggcgctggagcccttggtaaagggcgag
caaccgctctcggcactcaccttcatgcgcggcgcggcattcaggctgggcggcgtggat
gcgtggatcagccgctcgggatacaccggcgaggacgggttcgaaatctccgtcccctcg
accaaggccgcggaactggcggacctgatctgcgcgcagccgcaggtgaagaccatcggc
cttggcgcgcgcgacagcctgcgccttgaagccggccttccgctctacggccacgacatg
accgacacggtcgatccggtcagcgcggaccttctgttcggcatcaacaagcgccgccgc
aacgagggcggcttcgtcggggccgacaaggtcctgccgttgatcgccagcggcgccgcc
acgcgccgcgtcggcctcgccatcgagggccgcatggccgcgcgcgaaggtgcgacagtg
ctttcgaacgacgccgaagtcggcaccgtcacctccggcggtttctcgcccagcctcgag
cggcccatcgccatggcctatgtgccggtcgatctggccgcgccgggcaccgccctttcc
atcgacgtgcgcggacgcaagctcgccgccagcgtcgtgtccatgcctttcgttccccac
cgttatcaccgcaaaggagccgcctga

DBGET integrated database retrieval system