KEGG   Novosphingobium aromaticivorans: Saro_1971
Entry
Saro_1971         CDS       T00322                                 

Name
(GenBank) 5-formyltetrahydrofolate cyclo-ligase
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_1971
Enzymes [BR:nar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     Saro_1971
SSDB
Motif
Pfam: 5-FTHF_cyc-lig
Other DBs
NCBI-ProteinID: ABD26411
UniProt: Q2G6W2
Position
2088711..2089298
AA seq 195 aa
MEGKNALRKELRARRNAHVAALDPRVRALMFMRPPSPVTALVPQDATVGVYLAGPGEAPA
TAYARHFHEAGHKIALPWFADRDSPMQFREWSSPWVDELLEPGPWQSIAQPQASAPVAKP
EVVFVPLVGFDAEGGRLGQGGGHYDRWIEAHPAAVRIGLAWDCQLVDRLPRETHDRALHA
VVTPTRIYGPWEQDK
NT seq 588 nt   +upstreamnt  +downstreamnt
gtggaaggcaagaatgcgctgcgcaaggaattgagggcgcggcgcaatgcccacgtggcg
gcgctcgacccgcgcgtaagggcgctgatgttcatgcgcccgccctccccggtgaccgca
ctggttccccaggatgcaaccgttggcgtctaccttgccgggcccggcgaggcccctgcc
acagcctatgcccgtcatttccacgaagccggacacaagatcgccctgccctggttcgcg
gaccgcgattcgccgatgcagtttcgcgagtggtcctcaccgtgggtggacgaattgctt
gagccgggcccatggcagagcatcgctcaaccgcaggcgagtgctcctgtcgcaaagccc
gaggtggtcttcgtcccccttgtcggatttgacgccgaaggcggacgccttgggcaaggt
ggcgggcactacgatcgatggatcgaggctcatccggcggcggtgcgcatcgggcttgcc
tgggattgccagctggtcgaccgccttccccgcgaaacgcatgaccgggcgcttcatgcg
gtggtaacgccgacgcgaatctacggaccgtgggagcaggacaagtga

DBGET integrated database retrieval system