KEGG   Novosphingobium aromaticivorans: Saro_1977
Entry
Saro_1977         CDS       T00322                                 

Name
(GenBank) thymidylate synthase
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00240  Pyrimidine metabolism
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
Module
nar_M00938  Pyrimidine deoxyribonuleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Saro_1977
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_1977
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     Saro_1977
SSDB
Motif
Pfam: Thymidylat_synt
Other DBs
NCBI-ProteinID: ABD26417
UniProt: Q2G6V6
Position
complement(2094575..2095525)
AA seq 316 aa
MAMSILRDSGRHYEWQYLDLMRRIWEHGDERVDRTGVGTRSVFGAELRFDLSDGRMPLLT
TKRVYWKTATREFLWFLTGNTNIRPLCAQGVEIWTDWPLDRYRKETGDDISRKDFSARIV
ADEAFALRWGDLGPVYGKQWVDWPVFEPVGDGLFRRREAGVNQVADVVDSLRHNPGSRRH
IIEGWNVAEIDRMALPPCHKTYQFHVSGNRLNGLLYQRSCDVALGLPFNLWGAALLVRLL
AQQCDLQPGELVWMGGDTHLYLNHADLVEAQLSREPEGDPRLAILRRPDSIFGYRIEDFE
VTGYAPQGHLSAPVAV
NT seq 951 nt   +upstreamnt  +downstreamnt
gtggccatgtccatcctgcgcgattccggccgccattacgaatggcaatatctcgatctc
atgcgccgcatttgggaacatggcgacgagcgggtagatcggaccggcgtcggtacgcgg
tcggtcttcggtgctgagctcagattcgatctttccgatgggcggatgccgttgctcact
accaaacgcgtctactggaagacggcaacgcgtgagttcctatggttcctgaccggcaat
accaatatccgccccctctgcgcgcagggtgtggagatctggaccgattggccgctcgac
cgttaccgcaaggagaccggggacgacatttcgcggaaggacttttcggcacggatcgtc
gcggacgaggcattcgcgttgcggtggggcgaccttggaccggtctatggcaagcaatgg
gtggactggccggtgttcgagcctgtgggcgacggcctgttccgccgacgcgaagccggc
gtgaaccaggtggcggacgtggttgattcgctgcggcataatcccggcagcaggcgtcac
atcatcgagggttggaacgtcgccgagatcgaccggatggcgctgcctccctgccacaag
acataccagttccacgtcagcggcaatcggctgaacggcttgctctatcaacgcagttgc
gacgtcgcgctggggcttcccttcaacctgtggggcgccgcactgctcgtacgtctgctg
gcccagcaatgtgaccttcaacccggcgaactggtttggatgggtggagatacgcatctc
tacctgaaccacgcggatctcgttgaagcgcaactttcgcgggaaccggagggtgatccg
cgccttgccatcctgcggcgaccggatagtatcttcggttaccggatcgaggatttcgag
gtgaccggatatgcaccgcaggggcacctttccgcgcctgttgccgtctga

DBGET integrated database retrieval system