KEGG   Novosphingobium aromaticivorans: Saro_2240
Entry
Saro_2240         CDS       T00322                                 

Name
(GenBank) serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00260  Glycine, serine and threonine metabolism
nar00460  Cyanoamino acid metabolism
nar00630  Glyoxylate and dicarboxylate metabolism
nar00670  One carbon pool by folate
nar00680  Methane metabolism
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01230  Biosynthesis of amino acids
nar01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_2240
  09102 Energy metabolism
   00680 Methane metabolism
    Saro_2240
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saro_2240
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Saro_2240
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_2240
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     Saro_2240
SSDB
Motif
Pfam: SHMT Aminotran_1_2 DegT_DnrJ_EryC1
Other DBs
NCBI-ProteinID: ABD26677
UniProt: Q2G646
Position
2382863..2384173
AA seq 436 aa
MTTATAAPEIRKAGFFTEHLETADAEVFAAIRGELKRQQTKIELIASENITSLAVLEATG
SVFTNKYAEGYPGKRYYGGCEYADVVENLAIERAKKLFGCNFANVQPNSGSQMNQAVFLA
LLQPGDSFMGLDLNSGGHLTHGSPVNMSGKWFKPIPYGVRADDHLIDMDEVARLARENKP
KLIIAGGTAYSRVWDFKRFREIADEVGAWLLVDMSHFSGLVAGGAHPSPFPHAHVVTSTT
HKSLRGPRSGIILTNDEDLAKKFNMAVFPGMQGGPLVHVIAAKAVAFGEALRPEFKAYAA
QIVANARALAEAVKDAGLSVVSGGTDNHLMLVDLSAKDVTGKAAEKGLDRAWLTCNKNGV
PFDKRSPFVTSGIRLGTPAGTTRGFREEEFRKIGALIGEVVDGLARNGEEGDGQVEQRVR
DRVAELCAQFPIYPEL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgaccactgccaccgcagcgccggaaatccgtaaagccggcttcttcaccgaacatctc
gagaccgcagacgccgaagtcttcgccgcgatccgtggcgagctgaagcgccagcagacc
aagatcgaactgatcgcgtccgagaacatcaccagcctggccgtgcttgaagcgaccggt
tcggtcttcaccaacaagtacgccgaaggctatccgggcaagcgctactacggcggctgc
gaatatgcagacgtggtcgaaaacctcgcgatcgagcgcgcgaagaagctgttcggctgc
aacttcgccaacgtccagcccaactcgggcagccagatgaaccaggccgtgttcctcgcg
ctgcttcagcctggcgacagcttcatgggcctcgacctcaattcgggcggccacctgacg
cacggttcgccggtcaacatgagcggcaagtggttcaagccgatcccctatggcgtgcgc
gccgacgatcacctgatcgacatggacgaggttgcccgccttgcccgcgagaacaagccc
aagctgatcatcgcaggcggcactgcatattcgcgcgtgtgggatttcaagcgcttccgc
gagatcgccgatgaagtgggcgcctggctgctggtcgacatgtcgcacttctccggcctc
gtcgctggcggtgcgcacccctcgcccttcccgcacgcccatgtcgtgaccagcacgacg
cacaagtcgctgcgcggtccgcgttcgggcatcatcctgaccaacgacgaggatctggcg
aagaagttcaacatggcggtgttccccggcatgcagggcggcccgctagtccacgtgatc
gcggcaaaggcggtcgcgtttggcgaagcgctgcgtcctgaattcaaggcctatgccgcg
cagatcgtcgccaacgcccgcgcgctggccgaagcggtcaaggacgccggcctttcggtc
gtctcgggtgggaccgacaaccacctgatgctggtcgatctttctgccaaggacgtgacg
ggcaaggccgccgagaaggggctcgaccgcgcctggctgacctgcaacaagaacggcgtc
cccttcgacaagcgctcgcccttcgtcacgtcgggcatccgcctcggcaccccggcgggc
acgacgcgcggtttccgcgaggaagagttccgcaagatcggcgcactgatcggtgaagtg
gtcgatggccttgcacgcaacggcgaagagggcgatggtcaggtggaacagcgcgtgcgc
gaccgtgtcgccgagctttgcgcgcagttcccgatctatccggagctttga

DBGET integrated database retrieval system