KEGG   Novosphingobium aromaticivorans: Saro_2860
Entry
Saro_2860         CDS       T00322                                 

Name
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADH) [EC:1.5.1.54]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_2860
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.54  methylenetetrahydrofolate reductase (NADH)
     Saro_2860
SSDB
Motif
Pfam: MTHFR
Other DBs
NCBI-ProteinID: ABD27296
UniProt: Q2G4C7
Position
complement(3083086..3083970)
AA seq 294 aa
MAKASLIHPNWDKAPDGITDGFSLEMTAKDEASLRDAAPLIPADTPIAVTFLPGEDVAAR
VAATVAVRQLGFEPMPHFSARRITSEDDFEGYLKAVVEQAGVERCFIVAGDPPEPVGPYF
DTSALIATGAFERSGIKAIGIGGHPEGHPNMTEAECWAVLEKKVAEIERRGMAPLIVTQF
GFDPDAFLAWLKELRARGIDAPVRIGVPGPAGIKRLLAFAARCGVGASTAVLKKYGISVT
NLLGTAGPDKLVDAFAKGLGPEHGKVRLHFYPFGGLTKTLEWIHGYNKKHGIGA
NT seq 885 nt   +upstreamnt  +downstreamnt
atggccaaggcatcgctcatccatcccaactgggacaaggcgcccgacgggatcaccgat
ggcttttcgctggagatgacggcgaaggacgaggcgtcgctgcgcgatgccgctccgctc
atcccggcagacacccccatcgcggtcaccttcctccccggcgaggatgtggccgcccgc
gttgccgccaccgtcgcggtgcgccagctcggcttcgagccgatgccccatttctccgcc
cgccggatcacttccgaggacgatttcgaaggctacctcaaggccgtggtcgaacaggcc
ggcgtagagcgctgcttcatcgtcgcgggcgatccgcccgagccggttggcccctacttc
gatacctcggcgctcatcgccaccggtgcattcgagcgcagcggcatcaaggccatcggc
atcggcgggcaccccgaaggccacccgaacatgaccgaggccgaatgctgggcggtcctc
gagaagaaggtcgcggaaatcgagcgtcgcggcatggccccgctgatcgtcacccagttc
ggtttcgatcccgacgctttcctcgcctggctcaaggaactgcgcgcgcgcggcatcgat
gcgccggtccgcatcggcgttcccggtcctgccgggatcaagcgtctgcttgccttcgcc
gcccgctgcggcgtcggcgcctcgaccgccgtgctcaagaagtacggcatatcggtcacg
aacctgctcggcaccgccgggccggacaagctggtcgatgccttcgccaagggcctcggc
cccgaacacggcaaggtccgcctgcacttctatcccttcggcggcctgaccaagacgctc
gaatggatccacggctacaacaagaagcacggcatcggagcctga

KEGG   Novosphingobium aromaticivorans: Saro_3208
Entry
Saro_3208         CDS       T00322                                 

Name
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADH) [EC:1.5.1.54]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_3208
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.54  methylenetetrahydrofolate reductase (NADH)
     Saro_3208
SSDB
Motif
Pfam: MTHFR
Other DBs
NCBI-ProteinID: ABD27643
UniProt: Q2G3D0
Position
complement(3425534..3426475)
AA seq 313 aa
MNASYDQLREARTALDTPLFAGLPGDIAVSFEFFPPKSDALMAQLWDVVETLAPLQPTFV
SVTYGAGGSTRDRTHGTVARIIKEAKLPAAAHLTCVDASKAEIREVAESYWEAGVRHIVA
LRGDMGAPGVPFTPHPDGYANAAELVAGLKQIAPFEISVAAYPESHPDSPDQQADIDNLK
RKLDAGATRAISQFFFEPETFFRFRDKLAAAGIDAPVLPGILPVSNVAQTRKFAAACGAA
IPAWMDGLFEGLDTHPASRQLVAATIAAEFCRRLYAGGVRDFHFYTLNRAELSYAICHLL
GLRPRTPALEKAA
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaacgccagctacgaccagctccgcgaggcccgcaccgcactcgacaccccgcttttt
gcagggctgccgggggacattgccgtctcgttcgagttcttcccgccaaagagcgatgcg
ctgatggcgcagctctgggatgtcgtcgaaacgctggcgccgctacagcctacgttcgtc
tccgtcacctacggcgcaggtggctcaacgcgcgatcgcactcacggcaccgttgcgcgg
atcatcaaggaggcgaagctgccagcggccgcgcacctcacttgcgtggacgctagcaag
gccgagattcgcgaagtcgccgaaagctactgggaagcgggcgttcgccatatcgttgcc
ctgcgcggcgacatgggtgcgcccggcgtgcccttcactccccacccggacggctatgcc
aacgcggccgaactcgtcgccgggctgaagcagatcgccccgttcgagatctcggtcgcc
gcctatccggaatcgcacccggactcgccggaccagcaggccgatatcgacaacctcaag
cgcaagctcgatgccggggccacgcgcgcaatcagccagttcttcttcgagcctgaaacc
ttcttccgcttccgcgacaagctggcggcggccggcatcgatgccccggtccttcccggc
atcctgccggtttccaacgtcgcccagacgcgcaagttcgccgccgcctgcggtgccgcg
atcccggcgtggatggacggcctgttcgaagggctagacacccaccccgcctcgcgccag
ctcgtcgccgcgactatcgccgccgagttctgccgccgcctctacgccggcggcgtgcgc
gatttccacttctacaccctcaaccgcgccgaactgtcctatgcgatctgccacctgctt
ggccttcgtccccggactccggcgctggagaaagccgcgtga

DBGET integrated database retrieval system