KEGG   Novosphingobium aromaticivorans: Saro_2862
Entry
Saro_2862         CDS       T00322                                 

Name
(GenBank) formyltetrahydrofolate deformylase
  KO
K01433  formyltetrahydrofolate deformylase [EC:3.5.1.10]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00630  Glyoxylate and dicarboxylate metabolism
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Saro_2862
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_2862
Enzymes [BR:nar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.10  formyltetrahydrofolate deformylase
     Saro_2862
SSDB
Motif
Pfam: Formyl_trans_N ACT ACT_6
Other DBs
NCBI-ProteinID: ABD27298
UniProt: Q2G4C5
Position
3085570..3086424
AA seq 284 aa
MSASLILTLSCEDKPGIVARVTGNLFEAGGNIREAQQFDDPLSGRFFMRVVFDPAEGSVE
HYRAAFAAVADHYAMEWNLRDTTVKRKVILMVSKFDHCLGDLLYRTRIGELPMDVVAILG
NHPKEALNISLIGDIPYHHLPITKDTKPQQEAEVKRIVTETGAELVVLARYMQILSDDLA
AFLSGRCINIHHSFLPSFKGAKPYHQAHARGVKMIGATGHYVTADLDEGPIIHQDVETVT
HADSPDDLVRKGRDVERRVLAEAVRLHLEDRALVNGNKTVVFKS
NT seq 855 nt   +upstreamnt  +downstreamnt
atgagcgcatcgctgattttgacgctgtcgtgcgaggacaagccgggcatcgtcgcccgg
gtcacgggcaacctgttcgaggcgggtggcaacattcgcgaggcgcagcaattcgacgat
ccgctgagcggccgtttcttcatgcgcgtggtgttcgatccggccgaaggttcggtcgag
cattaccgcgcggccttcgcggcggtggccgaccactatgcaatggaatggaacctgcgc
gacacgaccgtgaagcggaaggtcatcctgatggtcagcaagttcgaccactgccttggc
gacttgctctaccgcacgcgaatcggcgaactgccgatggacgtcgtggcgatcctcggc
aaccatcccaaggaagcgctcaacatctcgctgatcggcgacattccctaccatcacctg
cccatcaccaaggacaccaagccacagcaggaagccgaagtgaagcgcatcgtcaccgag
acgggcgcggaactggttgtactggcgcgctacatgcagatcctttcggacgacctcgcc
gcgttcctttcgggccgctgcatcaacatccaccactcgttcctgccgagcttcaagggc
gccaagccctatcaccaggcgcatgcccgcggcgtgaagatgatcggcgcgaccggccac
tacgtgaccgccgacctcgacgaaggcccgatcatccaccaggacgtggaaacggtgacc
cacgccgacagcccggatgacctggtacgcaagggccgcgacgttgagcgccgcgtgctg
gccgaagcggtgcgcctgcatcttgaagaccgcgcactggtcaacggcaacaagaccgtc
gtgttcaagagctga

DBGET integrated database retrieval system